Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

MTHFD1L Polyclonal antibody

MTHFD1L Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 16113-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

EC:6.3.4.3, FTHFSDC1, Monofunctional C1-tetrahydrofolate synthase, mitochondrial, MTC1THFS

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, COLO 320 cells, mouse ovary tissue, HeLa cells, HepG2 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16113-1-AP targets MTHFD1L in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9036

Product name: Recombinant human MTHFD1L protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 427-775 aa of BC017477

Sequence: GRMVVASDKSGQPVTADDLGVTGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSVLADKIALKLVGEEGFVVTEAGFGADIGMEKFFNIKCRASGLVPNVVVLVATVRALKMHGGGPSVTAGVPLKKEYTEENIQLVADGCCNLQKQIQITQLFGVPVVVALNVFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQGFGNLPICMAKTHLSLSHQPDKKGVPRDFILPISDVRASIGAGFIYPLVGTMSTMPGLPTRPCFYDIDLDTETEQVKGLF

Predict reactive species
Full Name methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
Calculated Molecular Weight 978 aa, 106 kDa
Observed Molecular Weight 106 kDa
GenBank Accession NumberBC017477
Gene Symbol MTHFD1L
Gene ID (NCBI) 25902
RRIDAB_2250974
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6UB35
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MTHFD1L(Monofunctional C1-tetrahydrofolate synthase, mitochondrial) is also named as FTHFSDC1(Formyltetrahydrofolate synthetase). MTHFD1L enzyme is present in mitochondria from normal embryonic tissues and embryonic fibroblast cell lines, and embryonic mitochondria possess the ability to synthesize formate from glycine. It catalyzes the final step in the mitochondrial conversion of 1-C units to formate in embryos. Moreover, MTHFD1L levels were substantially higher in embryonic mitochondria than in adult liver mitochondria and embryonic mitochondria exhibited greater formate production(PMID:19948730). It has 2 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
IF protocol for MTHFD1L antibody 16113-1-APDownload protocol
IHC protocol for MTHFD1L antibody 16113-1-APDownload protocol
IP protocol for MTHFD1L antibody 16113-1-APDownload protocol
WB protocol for MTHFD1L antibody 16113-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

Cell Metab

Fibroblast Growth Factor 21 Drives Dynamics of Local and Systemic Stress Responses in Mitochondrial Myopathy with mtDNA Deletions.

Authors - Saara Forsström
humanWB

Cell Metab

Tumor Reliance on Cytosolic versus Mitochondrial One-Carbon Flux Depends on Folate Availability.

Authors - Won Dong Lee
humanWB

Nat Metab

Formate overflow drives toxic folate trapping in MTHFD1 inhibited cancer cells

Authors - Alanna C Green
mouse,humanWB

Cell Metab

Mitochondrial DNA Replication Defects Disturb Cellular dNTP Pools and Remodel One-Carbon Metabolism.

Authors - Joni Nikkanen
humanWB,IHC

J Pineal Res

Melatonin modulates metabolic remodeling in HNSCC by suppressing MTHFD1L-formate axis.

Authors - Li Cui
  • KD Validated
humanWB

Nat Commun

Increased formate overflow is a hallmark of oxidative cancer.

Authors - Johannes Meiser

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Lili (Verified Customer) (01-30-2026)

Really great antibody. Only tested it in western blots.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human cell lines
MTHFD1L Antibody Western Blot validation (1:1000 dilution) in Human cell lines (Cat no:16113-1-AP)

Furkan Emre (Verified Customer) (02-21-2022)

I am satisfied with the antibody. It worked as I was expecting from it. I would buy it again. I also add a figure showing chemiluminescence detection of MTHFD1L using your antibody.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human ES2 cells
MTHFD1L Antibody Western Blot validation (1:1000 dilution) in Human ES2 cells (Cat no:16113-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...