Tested Applications
| Positive WB detected in | HEK-293T cells, human brain tissue, HeLa cells, Jurkat cells |
| Positive IHC detected in | human normal colon, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IHC | See 2 publications below |
Product Information
13508-1-AP targets MTPN in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4419 Product name: Recombinant human MTPN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC028093 Sequence: MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ Predict reactive species |
| Full Name | myotrophin |
| Calculated Molecular Weight | 118 aa, 13 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC028093 |
| Gene Symbol | MTPN |
| Gene ID (NCBI) | 136319 |
| RRID | AB_2148129 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P58546 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Myotrophin (MTPN) is a ubiquitously expressed 12 kDa cytoplamic protein that was first isolated from the hearts of spontaneously hypertensive rats. Protein sequence analysis revealed that MTPN was composed of 118 amino acids and was occupied by two and a half internal 33 amino acid ankyrin repeats. MTPN stimulates protein synthesis and increases the expression of a number of cardiac marker genes (such as atrial natriuretic factor and b-myosin heavy chain) in cardiomyocytes leading to hypertrophy. In skeletal muscle, MTPN is also a positive growth factor in promoting skeletal muscle growth.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MTPN antibody 13508-1-AP | Download protocol |
| IHC protocol for MTPN antibody 13508-1-AP | Download protocol |
| WB protocol for MTPN antibody 13508-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Am J Obstet Gynecol Trophoblast apoptosis from pregnancies complicated by fetal growth restriction is associated with enhanced p53 expression. | ||
J Clin Biochem Nutr Upregulation of ENDOU in cytotrophoblasts from placenta complicated with preeclampsia and fetal growth restriction. |













