Tested Applications
Positive WB detected in | HEK-293T cells |
Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 2 publications below |
Product Information
24015-1-AP targets MUTED/BLOC1S5 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21226 Product name: Recombinant human MUTED protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC119644 Sequence: MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGLREMRVLENLKNMIHETNEHTLPKCRDTMRDSLSQVLQR Predict reactive species |
Full Name | muted homolog (mouse) |
Calculated Molecular Weight | 187 aa, 22 kDa |
Observed Molecular Weight | 22-25 kDa |
GenBank Accession Number | BC119644 |
Gene Symbol | MUTED |
Gene ID (NCBI) | 63915 |
RRID | AB_2879402 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8TDH9 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BLOC1S5 (biogenesis of lysosomal organelles complex 1 subunit 5) encodes a subunit of the BLOC1, a complex that is involved in transport of some but not all cargo to the lysosome and lysosome-related organelles. BLOC1S5 has a crucial role in STING-mediated cell death upon stimulation with low concentrations of CMA(PMID: 29033128).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MUTED/BLOC1S5 antibody 24015-1-AP | Download protocol |
IF protocol for MUTED/BLOC1S5 antibody 24015-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell The DNA Inflammasome in Human Myeloid Cells Is Initiated by a STING-Cell Death Program Upstream of NLRP3.
| ||