Tested Applications
| Positive WB detected in | Jurkat cells, A549 cells, HepG2 cells, MCF-7 cells, K-562 cells, Raji cells |
| Positive IP detected in | K-562 cells, A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 5 publications below |
| WB | See 221 publications below |
| IHC | See 12 publications below |
| IF | See 12 publications below |
| IP | See 2 publications below |
| CoIP | See 1 publications below |
Product Information
23230-1-AP targets MYD88 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, canine, monkey, chicken, bovine, sheep, duck |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19770 Product name: Recombinant human MYD88 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC013589 Sequence: MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTL Predict reactive species |
| Full Name | myeloid differentiation primary response gene (88) |
| Calculated Molecular Weight | 33 kDa |
| Observed Molecular Weight | 33 kDa |
| GenBank Accession Number | BC013589 |
| Gene Symbol | MYD88 |
| Gene ID (NCBI) | 4615 |
| RRID | AB_2879236 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99836 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Myeloid differentiation primary response 88 (MYD88) is an adapter protein critical to the innate and adaptive immune response.
What is the molecular weight of MYD88?
The molecular weight of MYD88 is 33 kDa.
What is the cellular localization of MYD88?
The subcellular localization of MYD88 is largely confined to the cytoplasm as condensed forms or aggregated structures.
What is the role of MYD88 in the IL-1R signaling pathway?
MYD88 plays a major role in the inflammatory signaling pathways downstream of Toll-like receptor (TLR) and interleukin-1 receptor (IL-1R) families. MYD88 links these receptors to IL-1R-associated kinases (IRAK), such as IRAK1 and IRAK2, via protein-protein interactions. The C-terminal TIR domain of MYD88 mediates the interaction with the receptors, whereas the N-terminal death domain of MYD88 associates with IRAK family members (PMID: 25580251). MYD88 acts via its intermediate domain to phosphorylate and thus activate IRAK1, IRAK2, IRF7, and TRAF6 to trigger NF-kappa-B signaling and cytokine secretion as part of the inflammatory response (PMID: 19679662).
What is MYD88's involvement in disease?
Defects in MYD88 due to deficiency of the protein leads to recurrent pyogenic bacterial infections, including invasive pneumococcal disease. Patients usually die between 1 and 11 months of age, but surviving patients are otherwise healthy with normal resistance to other microbes (PMID: 18669862). Mutations in the MYD88 gene also lead to the development of cancers such as lymphoma (PMID: 21179087) and some autoimmune disorders like ulcerative colitis (PMID: 24189845).
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for MYD88 antibody 23230-1-AP | Download protocol |
| WB protocol for MYD88 antibody 23230-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Mater Manganese@Albumin Nanocomplex and Its Assembled Nanowire Activate TLR4-Dependent Signaling Cascades of Macrophages | ||
Mol Cell Serine synthesis sustains macrophage IL-1β production via NAD+-dependent protein acetylation | ||
Mol Cell CPT1A induction following epigenetic perturbation promotes MAVS palmitoylation and activation to potentiate antitumor immunity
| ||
Adv Sci (Weinh) OR11H1 Missense Variant Confers the Susceptibility to Vogt-Koyanagi-Harada Disease by Mediating Gadd45g Expression | ||
Gut Microbes Fusobacterium nucleatum promotes esophageal squamous cell carcinoma progression and chemoresistance by enhancing the secretion of chemotherapy-induced senescence-associated secretory phenotype via activation of DNA damage response pathway | ||
Nucleic Acids Res The N6-methyladenosine RNA-binding protein YTHDF1 modulates the translation of TRAF6 to mediate the intestinal immune response. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Zhiqiang (Verified Customer) (12-04-2025) | This antibody works very well for western blot and immunostaining.
|
FH Rouba (Verified Customer) (07-05-2022) | Antibody was diluted to the 1/100 in blocking solution and incubated ON at 4 degrees celcius
![]() |
FH Cassand (Verified Customer) (10-22-2021) | Nice antibody works good.
![]() |













