Filter:
Tested Applications
| Positive WB detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26151-1-AP targets MYEOV2 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23560 Product name: Recombinant human MYEOV2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-57 aa of BC033955 Sequence: MKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDIQ Predict reactive species |
| Full Name | myeloma overexpressed 2 |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC033955 |
| Gene Symbol | MYEOV2 |
| Gene ID (NCBI) | 150678 |
| RRID | AB_2880405 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8WXC6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MYEOV2, also known as Myeloma-overexpressed gene 2 protein, is a low abundance protein. The function of MYEOV2 remains largely unknown. MYEOV2 has 2 isoforms with MW 27 kDa and 6 kDa according to UniProt. Catalog#26151-1-AP specially recognises the 27 kDa isoform.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for MYEOV2 antibody 26151-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
