Tested Applications
Positive WB detected in | mouse colon tissue, Caco-2 cells, rat colon tissue |
Positive IHC detected in | human liver cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse heart tissue |
Positive IF/ICC detected in | MCF-7 cells, C2C12 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:5000 |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 9 publications below |
IHC | See 2 publications below |
IF | See 3 publications below |
IP | See 1 publications below |
Product Information
15354-1-AP targets MYL9 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag7600 Product name: Recombinant human MYL9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC002648 Sequence: MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD Predict reactive species |
Full Name | myosin, light chain 9, regulatory |
Calculated Molecular Weight | 20 kDa |
Observed Molecular Weight | 20 kDa |
GenBank Accession Number | BC002648 |
Gene Symbol | MYL9 |
Gene ID (NCBI) | 10398 |
RRID | AB_2147773 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P24844 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Myosin regulatory light polypeptide 9 (MYL9), also known as MLC2, belongs to the myosin regulatory subunits. It plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation at Thr19 and Ser20. Implicated in cytokinesis, receptor capping, and cell locomotion (PMID:11942626, PMID:2526655). Some studies have demonstrated that MYL9 may play important roles in various human cancers. The expression and phosphorylation of MYL9 (Thr19/Ser20) may be increased in human breast (PMID: 22144583) and liver cancers (PMID: 18648664), while decreased in human colon (PMID: 22752057) and bladder cancers (PMID: 21139803). MYL9 was the only gene differentially expressed in the aged versus young injured arteries in the rat smooth muscle cell layers (PMID:22003410).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MYL9 antibody 15354-1-AP | Download protocol |
IHC protocol for MYL9 antibody 15354-1-AP | Download protocol |
IF protocol for MYL9 antibody 15354-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Biol Chem Brain-Derived Neurotrophic Factor regulates LYN kinase mediated Myosin Light Chain Kinase activation to modulate non-muscle myosin II activity in hippocampal neurons. | ||
Sci Rep Proteomic profiling of concurrently isolated primary microvascular endothelial cells, pericytes, and vascular smooth muscle cells from adult mouse heart. | ||
Front Med (Lausanne) Depiction of Aging-Based Molecular Phenotypes With Diverse Clinical Prognosis and Immunological Features in Gastric Cancer.
| ||
Oncol Rep Fenretinide inhibits the proliferation and migration of human liver cancer HepG2 cells by downregulating the activation of myosin light chain kinase through the p38‑MAPK signaling pathway. | ||
JCI Insight Transient expansion and myofibroblast conversion of adipogenic lineage precursors mediate bone marrow repair after radiation. | ||
Front Cell Dev Biol Paracrine HB-EGF signaling reduce enhanced contractile and energetic state of activated decidual fibroblasts by rebalancing SRF-MRTF-TCF transcriptional axis |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Irem (Verified Customer) (05-18-2022) | 20 kDa band can be observed but there are other unspesific bands. Marker: Pageruler protein prestained marker
![]() |