MYOM3 Polyclonal antibody

MYOM3 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA
Cat No. 17692-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-P, IP, ELISA

Myomesin-3, Myomesin family member 3, Myomesin 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse skeletal muscle tissue, rat skeletal muscle tissue
Positive IP detected inmouse skeletal muscle tissue
Positive IHC detected inhuman skeletal muscle tissue, mouse skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse skeletal muscle tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:400
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17692-1-AP targets MYOM3 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11849

Product name: Recombinant human MYOM3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 888-1213 aa of BC067101

Sequence: SMPTDPVLLEDKPGAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQYDPETGTGLLCIEEASVAPASGLTFSFGCKPGRAKSSGLGVRAGPRLG

Predict reactive species
Full Name myomesin family, member 3
Calculated Molecular Weight 162 kDa, 136 kDa
Observed Molecular Weight 162 kDa
GenBank Accession NumberBC067101
Gene Symbol MYOM3
Gene ID (NCBI) 127294
RRIDAB_2146624
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ5VTT5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MYOM3 (myomesin 3) is a structural component of the M-band in striated muscle and is involved in sarcomere stability and resistance during intense or sustained stretching. MYOM3 can be detected mainly in intermediate-speed fibers of skeletal muscle. Recently high levels of MYOM3 fragments were detected in sera from patients with muscular dystrophy, including Duchenne muscular dystrophy (DMD). MYOM3 fragments may be used as serum biomarkers for DMD and other neuromuscular disorders. This antibody recognizes the intact MYOM3 protein (160-162 kDa) as well as MYOM3 fragments (100 kDa and 130 kDa). (26060189)

Protocols

Product Specific Protocols
IF protocol for MYOM3 antibody 17692-1-APDownload protocol
IHC protocol for MYOM3 antibody 17692-1-APDownload protocol
IP protocol for MYOM3 antibody 17692-1-APDownload protocol
WB protocol for MYOM3 antibody 17692-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ELISA

Nat Commun

An engineered AAV targeting integrin alpha V beta 6 presents improved myotropism across species

Authors - Ai Vu Hong
mouseWB

J Clin Invest

A functional mini-GDE transgene corrects impairment in models of glycogen storage disease type III

Authors - Antoine Gardin
mouseWB

Nucleic Acids Res

Palmitic acid conjugation enhances potency of tricyclo-DNA splice switching oligonucleotides.

Authors - Karima Relizani
humanWB, IP

Hum Mol Genet

Serum proteomic profiling reveals fragments of MYOM3 as potential biomarkers for monitoring the outcome of therapeutic interventions in muscular dystrophies.

Authors - Jérémy Rouillon
mouseWB

Int J Mol Sci

Co-Administration of Simvastatin Does Not Potentiate the Benefit of Gene Therapy in the mdx Mouse Model for Duchenne Muscular Dystrophy.

Authors - Nathalie Bourg
humanIF

Stem Cell Reports

A Human Stem Cell Model of Fabry Disease Implicates LIMP-2 Accumulation in Cardiomyocyte Pathology.

Authors - Matthew J Birket
Loading...
||
New chat Able
正在加载,请稍候...