Tested Applications
Positive WB detected in | DC2.4 cells, LPS treated RAW 264.7 cells, mouse brain tissue, mouse lung tissue, mouse kidney tissue, mouse placenta tissue |
Positive IHC detected in | mouse kidney tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 104 publications below |
IHC | See 33 publications below |
IF | See 22 publications below |
CoIP | See 1 publications below |
Product Information
66272-1-Ig targets Mcp1 in WB, IHC, IF-P, CoIP, ELISA applications and shows reactivity with mouse samples.
Tested Reactivity | mouse |
Cited Reactivity | mouse, rabbit |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24085 Product name: Recombinant mouse Mcp1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 24-148 aa of NM-011333 Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN Predict reactive species |
Full Name | chemokine (C-C motif) ligand 2 |
Observed Molecular Weight | 26 kDa |
GenBank Accession Number | NM-011333 |
Gene Symbol | MCP-1/CCL2 |
Gene ID (NCBI) | 20296 |
RRID | AB_2861337 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P10148 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Monocyte chemoattractant protein-1 (MCP-1/CCL2) is one of the key chemokines that regulate migration and infiltration of monocytes/macrophages. Both CCL2 and its receptor CCR2 have been demonstrated to be induced and involved in various diseases. Migration of monocytes from the blood stream across the vascular endothelium is required for routine immunological surveillance of tissues, as well as in response to inflammation.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Mcp1 antibody 66272-1-Ig | Download protocol |
IHC protocol for Mcp1 antibody 66272-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Gut Cross-talk between the gut microbiota and monocyte-like macrophages mediates an inflammatory response to promote colitis-associated tumourigenesis. | ||
Hepatology Single-cell transcriptomic analysis reveals a hepatic stellate cell-activation roadmap and myofibroblast origin during liver fibrosis. | ||
Cell Rep Med Lnc-H19-derived protein shapes the immunosuppressive microenvironment of glioblastoma | ||
Cell Death Differ Ferroptotic stress facilitates smooth muscle cell dedifferentiation in arterial remodelling by disrupting mitochondrial homeostasis | ||
Nat Commun Deficiency of WTAP in hepatocytes induces lipoatrophy and non-alcoholic steatohepatitis (NASH) |