Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Nanog Polyclonal antibody

Nanog Polyclonal Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 14295-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (5)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

hNanog

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNTERA-2 cl.D1 cells
Positive IF/ICC detected inhuman embronic stem cells
Positive FC (Intra) detected inNCCIT cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunofluorescence (IF)/ICCIF/ICC : 1:20-1:200
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14295-1-AP targets Nanog in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat, pig, chicken, marmoset
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5645

Product name: Recombinant human NANOG protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-305 aa of BC160187

Sequence: MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV

Predict reactive species
Full Name Nanog homeobox
Calculated Molecular Weight 35 kDa
Observed Molecular Weight42 kDa
GenBank Accession NumberBC160187
Gene Symbol Nanog
Gene ID (NCBI) 79923
RRIDAB_1607719
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H9S0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nanog is a member of the homeobox family of DNA binding transcription factors and has been shown to maintain embryonic stem (ES) cell self-renewal independently of leukemia inhibitory factor (LIF)/Stat3. Nanog mRNA is present in pluripotent mouse and human cell lines, and absent from differentiated cells. Functionally, Nanog works together with other key pluripotent factors (Oct4, Sox2, and Lin28) to reprogram human fibroblasts and generate induced pluripotent stem (iPS) cells. These key factors form a regulatory network to support or limit each other's expression level, which maintains the properties of ES cells. Affinity purified rabbit anti-Nanog can be used to demonstrate pluripotency of ES and IPS cells. There are two kinds of variants that can be recognized by NANOG, one is a normal form (~39 kDa), the other is a post-translation modified form (~48 kDa) (21136380 ). Nanog has two isoforms with molecular weights of 34.4 kDa and 31.9 kDa. (PMID: 21969378)

Protocols

Product Specific Protocols
FC protocol for Nanog antibody 14295-1-APDownload protocol
WB protocol for Nanog antibody 14295-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

Cell Stem Cell

A combined cell and gene therapy approach for homotopic reconstruction of midbrain dopamine pathways using human pluripotent stem cells.

Authors - Niamh Moriarty
humanIF

Cell Stem Cell

Decoding the temporal and regional specification of microglia in the developing human brain.

Authors - Yanxin Li
humanIF

Cell Stem Cell

A cloaked human stem-cell-derived neural graft capable of functional integration and immune evasion in rodent models

Authors - Chiara Pavan
mouseWB

Mol Cancer

Circular RNA circIPO11 drives self-renewal of liver cancer initiating cells via Hedgehog signaling.

Authors - Yang Gu
mouse

Mol Cell

RNA Targets Ribogenesis Factor WDR43 to Chromatin for Transcription and Pluripotency Control.

Authors - Xianju Bi
mouseIF

Nat Commun

Klf4 glutamylation is required for cell reprogramming and early embryonic development in mice.

Authors - Buqing Ye

Reviews

    4.6 out of 5
Add a review

6 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Claudia (Verified Customer) (03-06-2026)

this antibody works well in my mESCs at 20µg with an overnight incubation

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:8000
  • Cell Tissue Type: mESCs

Cristine (Verified Customer) (11-09-2025)

The NANOG antibody worked very well and with high specificity at the dilution of 1:50 after overnight incubation at 4oC in immunocytochemistry assays of human induced pluripotent stem cells.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: Human Induced Pluripotent Stem Cells

Chunxu (Verified Customer) (05-27-2025)

This antibody works very well in WB and IF to determine the stemness either cancer stem cells or mouse embryonic stem cells.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: SKOV3, mESCs

Fatemeh (Verified Customer) (05-22-2023)

50 ug of protein lysate was used for WB. Blot was blocked with 5% milk and incubated with 1-1000 primary antibody overnight at 4C.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1-1000
  • Cell Tissue Type: mESCs
Nanog Antibody Western Blot validation (1-1000 dilution) in mESCs (Cat no:14295-1-AP)

Udesh (Verified Customer) (02-24-2023)

Worked well at 1:1000 in 5% BSA O/N at 4 degrees

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: U2OS Osteosarcoma cells
Nanog Antibody Western Blot validation (1:1000 dilution) in U2OS Osteosarcoma cells (Cat no:14295-1-AP)

Ying (Verified Customer) (08-19-2019)

very good antibody.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: mouse primary cardiomyocytes
Loading...
||
New chat

Able

正在加载,请稍候...