Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

NCAM1/CD56 Polyclonal antibody

NCAM1/CD56 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 14255-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IF-P, ELISA

CD56, NCAM1, MSK39, N CAM 1, NCAM

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, Neuro-2a cells, rat brain tissue, pig brain tissue
Positive IHC detected inhuman tonsillitis tissue, human appendicitis tissue, human colon tissue, human lung cancer tissue, Insulinoma tissue, mouse brain tissue, mouse colon tissue, rat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse colon tissue
Positive IF/ICC detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:8000-1:32000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14255-1-AP targets NCAM1/CD56 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5528

Product name: Recombinant human NCAM1/CD56 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 30-352 aa of BC047244

Sequence: EISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEE

Predict reactive species
Full Name neural cell adhesion molecule 1
Calculated Molecular Weight 95 kDa
Observed Molecular Weight 120 kDa, 140 kDa, 180 kDa
GenBank Accession NumberBC047244
Gene Symbol NCAM1
Gene ID (NCBI) 4684
ENSEMBL Gene IDENSG00000149294
RRIDAB_2149421
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP13591
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Neural cell adhesion molecule 1 (NCAM1, also known as CD56) is a cell adhesion glycoprotein of the immunoglobulin (Ig) superfamily. It is a multifunction protein involved in synaptic plasticity, neurodevelopment, and neurogenesis. NCAM1 is expressed on human neurons, glial cells, skeletal muscle cells, NK cells and a subset of T cells, and the expression is observed in a wide variety of human tumors, including myeloma, myeloid leukemia, neuroendocrine tumors, Wilms' tumor, neuroblastoma, and NK/T cell lymphomas. Three major isoforms of NCAM1, with molecular masses of 120, 140, and 180 kDa, are generated by alternative splicing of mRNA (PMID: 9696812). The glycosylphosphatidylinositol (GPI)-anchored NCAM120 and the transmembrane NCAM140 and NCAM180 consist of five Ig-like domains and two fibronection-type III repeats (FNIII). All three forms can be posttranslationally modified by addition of polysialic acid (PSA) (PMID: 14976519). Several other isofroms have also been described (PMID: 1856291).

Protocols

Product Specific Protocols
IF protocol for NCAM1/CD56 antibody 14255-1-APDownload protocol
IHC protocol for NCAM1/CD56 antibody 14255-1-APDownload protocol
WB protocol for NCAM1/CD56 antibody 14255-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseIF

Nat Med

Selective modulation of the androgen receptor AF2 domain rescues degeneration in spinal bulbar muscular atrophy.

Authors - Nisha M Badders
humanIHC

Nat Immunol

Short IL-18 generated by caspase-3 cleavage mobilizes NK cells to suppress tumor growth

Authors - Junchen Shen
humanIF

Cell Metab

Multiplexed In Situ Imaging Mass Cytometry Analysis of the Human Endocrine Pancreas and Immune System in Type 1 Diabetes.

Authors - Yue J Wang
mouseIF

Sci Adv

Gene therapy with AR isoform 2 rescues spinal and bulbar muscular atrophy phenotype by modulating AR transcriptional activity.

Authors - Wooi F Lim
mouseWB,IHC,IF

Hepatology

PolySia-NCAM modulates the formation of ductular reactions in liver injury.

Authors - Atsunori Tsuchiya
humanIHC

J Clin Invest

Thioredoxin activity confers resistance against oxidative stress in tumor-infiltrating NK cells.

Authors - Ying Yang

Reviews

    5.0 out of 5
Add a review

3 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Kenzo (Verified Customer) (01-09-2023)

Worked great. The staining pattern was consistent with what has been reported.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: Mouse nerve tissue

Emma (Verified Customer) (11-29-2021)

Works well by IF on FFPE tissue @ 1:1000. We used a Tris-EDTA antigen retrieval.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Prostate
NCAM1/CD56 Antibody Immunofluorescence validation (1:1000 dilution) in Prostate (Cat no:14255-1-AP)

Toni (Verified Customer) (02-28-2019)

IP conditions:1ug of rbt anti-NCAM1 was added to 100ug human cortex homogenate (0.5ug/ul) in Tris-sucrose buffer with 1% SDS and 1% Triton X100 thenincubated rotating ON at 4C. Sample was then added to 50ul TBST-washed sheep anti-rabbit magnetic beads and incubated rotating 3hr at 4C. Following 4 TBST washes, bound proteins were eluted with 30ul of elution buffer containing SDS and BME. WB conditions:Samples subjected to SDS-PAGE on 4-12% Bis-Tris gels followed by semi-dry transfer to nitrocellulose membranes using standard conditions. Membranes were blocked for 1hr at RT in 50% LiCor Odyssey blocking buffer (TBS) then probed with either 1:5000 (v/v) rabbit anti-NCAM1 (Proteintech) or 1:1000 (v/v) goat anti-NCAM1 (R&D Systems) in 50% LiCor Odyssey blocking buffer (TBS + 0.05% Tween-20) ON at 4C. Following TBS+ 0.1% Tween-20 washes, membranes were incubated with the appropriate IR-dye labeled secondary antibody for 1hr at RT, TBST washed, then scanned.*you have my permission to edit the comments above and crop, but not alter, the image provided if you wish to remove reference to an antibody from another company.

  • Applications: Western Blot, Immunoprecipitation,
  • Primary Antibody Dilution: 1:5000 in 50% LiCor Odyssey Blocking Buffer (TBS+0.1%Tween 20)
  • Cell Tissue Type: postmortem human cortex
NCAM1/CD56 Antibody Western Blot,Immunoprecipitation, validation (1:5000 in 50% LiCor Odyssey Blocking Buffer (TBS+0.1%Tween 20) dilution) in postmortem human cortex (Cat no:14255-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...