Tested Applications
Positive WB detected in | fetal human brain tissue, C6 cells, human brain tissue, pig brain tissue |
Positive IHC detected in | human lung cancer tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | human colon tissue, human tonsillitis tissue |
Positive IF/ICC detected in | SH-SY5Y cells, human colon tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:8000 |
Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IHC | See 4 publications below |
IF | See 4 publications below |
Product Information
60238-1-Ig targets NCAM1/CD56 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, rat, pig samples.
Tested Reactivity | human, rat, pig |
Cited Reactivity | human, mouse |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag5732 Product name: Recombinant human NCAM1/CD56 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 30-352 aa of BC047244 Sequence: EISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEE Predict reactive species |
Full Name | neural cell adhesion molecule 1 |
Calculated Molecular Weight | 95 kDa |
Observed Molecular Weight | 140 kDa |
GenBank Accession Number | BC047244 |
Gene Symbol | NCAM1 |
Gene ID (NCBI) | 4684 |
ENSEMBL Gene ID | ENSG00000149294 |
RRID | AB_2881361 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P13591 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Neural cell adhesion molecule 1 (NCAM1, also known as CD56) is a cell adhesion glycoprotein of the immunoglobulin (Ig) superfamily. It is a multifunction protein involved in synaptic plasticity, neurodevelopment, and neurogenesis. NCAM1 is expressed on human neurons, glial cells, skeletal muscle cells, NK cells and a subset of T cells, and the expression is observed in a wide variety of human tumors, including myeloma, myeloid leukemia, neuroendocrine tumors, Wilms' tumor, neuroblastoma, and NK/T cell lymphomas. Three major isoforms of NCAM1, with molecular masses of 120, 140, and 180 kDa, are generated by alternative splicing of mRNA (PMID: 9696812). The glycosylphosphatidylinositol (GPI)-anchored NCAM120 and the transmembrane NCAM140 and NCAM180 consist of five Ig-like domains and two fibronection-type III repeats (FNIII). All three forms can be posttranslationally modified by addition of polysialic acid (PSA) (PMID: 14976519). Several other isofroms have also been described (PMID: 1856291).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NCAM1/CD56 antibody 60238-1-Ig | Download protocol |
IHC protocol for NCAM1/CD56 antibody 60238-1-Ig | Download protocol |
IF protocol for NCAM1/CD56 antibody 60238-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Small Nanobody-Engineered Natural Killer Cell Conjugates for Solid Tumor Adoptive Immunotherapy | ||
J Transl Med Systematic analysis of various RNA transcripts and construction of biological regulatory networks at the post-transcriptional level for chronic obstructive pulmonary disease | ||
Rheumatology (Oxford) Interleukin-6 trans-signaling regulates monocyte chemoattractant protein-1 production in immune-mediated necrotizing myopathy | ||
Stem Cells Dev Effect of the Soluble Factors Released by Dental Apical Papilla-Derived Stem Cells on the Osteo/Odontogenic, Angiogenic, and Neurogenic Differentiation of Dental Pulp Cells. | ||
Jpn J Clin Oncol Identification of distinct genomic features reveals frequent somatic AHNAK and PTEN mutations predominantly in primary malignant melanoma presenting in the ureter. | ||
Hepatology Hepatocyte-derived MASP1-enriched small extracellular vesicles activate HSCs to promote liver fibrosis |