Tested Applications
Positive WB detected in | HEK-293 cells, HeLa cells, SH-SY5Y cells |
Positive IP detected in | HEK-293 cells |
Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 3 publications below |
IHC | See 1 publications below |
IF | See 2 publications below |
IP | See 2 publications below |
Product Information
15602-1-AP targets NDFIP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag7985 Product name: Recombinant human NDFIP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC004317 Sequence: MALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFM Predict reactive species |
Full Name | Nedd4 family interacting protein 1 |
Calculated Molecular Weight | 25 kDa |
Observed Molecular Weight | 25-30 kDa |
GenBank Accession Number | BC004317 |
Gene Symbol | NDFIP1 |
Gene ID (NCBI) | 80762 |
RRID | AB_2878157 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9BT67 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ndfip1 is an adaptor protein for the Nedd4 family of ubiquitin ligases and has been found to be upregulated in neurons after brain injury, including head trauma, stroke and metal toxicity. Recent studies confirmed the role of Ndfip1 as a regulator of iron metabolism and pointed out that Ndfip1 was involved in iron homeostasis by regulating the degradation of iron importer divalent metal transporter 1. Ndfip1 is a transmembrane protein that is localized to the Golgi and post-Golgi vesicles such as endosomes. It is an adaptor protein that recruits E3 ligases to ubiquitinate target proteins. It is ubiquitously expressed and contains 2 PY motifs, which interact with several Nedd4 family E3s to degradate proteins.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NDFIP1 antibody 15602-1-AP | Download protocol |
IF protocol for NDFIP1 antibody 15602-1-AP | Download protocol |
IP protocol for NDFIP1 antibody 15602-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Mol Cell PKCλ/ι inhibition activates an ULK2-mediated interferon response to repress tumorigenesis. | ||
J Neurooncol Cabergoline-induced NDFIP1 upregulation in pituitary neuroendocrine tumor cells activates mTOR signaling and contributes to cabergoline resistance | ||
Cell Death Discov WWP1 upregulation predicts poor prognosis and promotes tumor progression by regulating ubiquitination of NDFIP1 in intrahepatic cholangiocarcinoma. | ||
Nat Chem Biol µMap proximity labeling in living cells reveals stress granule disassembly mechanisms
|