Tested Applications
Positive WB detected in | COLO 320 cells, HeLa cells, HUVEC cells, HepG2 cells, Jurkat clells, PC-3 cells |
Positive IP detected in | HeLa cells |
Positive IHC detected in | human liver cancer tissue, human kidney tissue, human liver tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 6 publications below |
WB | See 12 publications below |
IHC | See 13 publications below |
IF | See 13 publications below |
IP | See 1 publications below |
CoIP | See 1 publications below |
Product Information
16480-1-AP targets NDUFA4L2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag9600 Product name: Recombinant human NDUFA4L2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC011910 Sequence: MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF Predict reactive species |
Full Name | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2 |
Calculated Molecular Weight | 87 aa, 10 kDa |
Observed Molecular Weight | 10 kDa |
GenBank Accession Number | BC011910 |
Gene Symbol | NDUFA4L2 |
Gene ID (NCBI) | 56901 |
RRID | AB_2150637 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NRX3 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NDUFA4L2(NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2), also named as NUOMS, is a HIF-1α target gene that localizes to the mitochondria and belongs to the complex I NDUFA4 subunit family. It downregulates oxygen consumption and Complex I activity in hypoxia. NDUFA4L2 is involved in hypoxic adaptation by decreasing mitochondrial ROS production.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NDUFA4L2 antibody 16480-1-AP | Download protocol |
IHC protocol for NDUFA4L2 antibody 16480-1-AP | Download protocol |
IF protocol for NDUFA4L2 antibody 16480-1-AP | Download protocol |
IP protocol for NDUFA4L2 antibody 16480-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Adv Sci (Weinh) Single-Cell Transcriptomic Analysis of Primary and Metastatic Tumor Ecosystems in Esophageal Squamous Cell Carcinoma | ||
Cell Metab Induction of the mitochondrial NDUFA4L2 protein by HIF-1α decreases oxygen consumption by inhibiting Complex I activity.
| ||
Ther Adv Med Oncol NDUFA4L2 promotes trastuzumab resistance in HER2-positive breast cancer. | ||
Sci Signal Acute O2 sensing through HIF2α-dependent expression of atypical cytochrome oxidase subunits in arterial chemoreceptors.
| ||
Nutrients Diosgenin Inhibits ROS Generation by Modulating NOX4 and Mitochondrial Respiratory Chain and Suppresses Apoptosis in Diabetic Nephropathy |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Josh (Verified Customer) (10-28-2021) | Clear, good signal at expected MW (10kDa) by western blot. Non specific bands at 50 and 70 kDa (and to a lesser extent, 15 and 100 kDa).
![]() |
FH Daniel (Verified Customer) (09-30-2019) | Kidney cancer mouse model stained for Ndufa4l2 (HRP detection by DAB stain).
![]() |