Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

NDUFA4L2 Polyclonal antibody

NDUFA4L2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16480-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

NUOMS, NADH-ubiquinone oxidoreductase MLRQ subunit homolog, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCOLO 320 cells, HeLa cells, HUVEC cells, HepG2 cells, Jurkat clells, PC-3 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman liver cancer tissue, human kidney tissue, human liver tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16480-1-AP targets NDUFA4L2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9600

Product name: Recombinant human NDUFA4L2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-87 aa of BC011910

Sequence: MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF

Predict reactive species
Full Name NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2
Calculated Molecular Weight 87 aa, 10 kDa
Observed Molecular Weight 10 kDa
GenBank Accession NumberBC011910
Gene Symbol NDUFA4L2
Gene ID (NCBI) 56901
RRIDAB_2150637
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NRX3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDUFA4L2(NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2), also named as NUOMS, is a HIF-1α target gene that localizes to the mitochondria and belongs to the complex I NDUFA4 subunit family. It downregulates oxygen consumption and Complex I activity in hypoxia. NDUFA4L2 is involved in hypoxic adaptation by decreasing mitochondrial ROS production.

Protocols

Product Specific Protocols
IF protocol for NDUFA4L2 antibody 16480-1-APDownload protocol
IHC protocol for NDUFA4L2 antibody 16480-1-APDownload protocol
IP protocol for NDUFA4L2 antibody 16480-1-APDownload protocol
WB protocol for NDUFA4L2 antibody 16480-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanIF

Adv Sci (Weinh)

Single-Cell Transcriptomic Analysis of Primary and Metastatic Tumor Ecosystems in Esophageal Squamous Cell Carcinoma

Authors - Yongxu Jia
humanWB

Cell Metab

Induction of the mitochondrial NDUFA4L2 protein by HIF-1α decreases oxygen consumption by inhibiting Complex I activity.

Authors - Daniel Tello
  • KD Validated
humanWB,IHC,IF,IP

Ther Adv Med Oncol

NDUFA4L2 promotes trastuzumab resistance in HER2-positive breast cancer.

Authors - Yuan Yuan
mouseIF

Sci Signal

Acute O2 sensing through HIF2α-dependent expression of atypical cytochrome oxidase subunits in arterial chemoreceptors.

Authors - Alejandro Moreno-Domínguez
  • KO Validated
human,ratWB

Nutrients

Diosgenin Inhibits ROS Generation by Modulating NOX4 and Mitochondrial Respiratory Chain and Suppresses Apoptosis in Diabetic Nephropathy

Authors - Yujie Zhong
ratWB

Basic Res Cardiol

Metabolic adaptation to chronic hypoxia in cardiac mitochondria.

Authors - Heather Lisa C LC

Reviews

    4.6 out of 5
Add a review

3 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Vignesh (Verified Customer) (11-18-2025)

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: HEPG2A cells

Josh (Verified Customer) (10-28-2021)

Clear, good signal at expected MW (10kDa) by western blot. Non specific bands at 50 and 70 kDa (and to a lesser extent, 15 and 100 kDa).

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: clear cell renal cell carcinoma cell line RCC4
NDUFA4L2 Antibody Western Blot validation (1:1000 dilution) in clear cell renal cell carcinoma cell line RCC4 (Cat no:16480-1-AP)

Daniel (Verified Customer) (09-30-2019)

Kidney cancer mouse model stained for Ndufa4l2 (HRP detection by DAB stain).

  • Applications: Immunohistochemistry,
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Mouse kidney (TRACK model)
NDUFA4L2 Antibody Immunohistochemistry, validation (1:200 dilution) in Mouse kidney (TRACK model) (Cat no:16480-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...