Tested Applications
Positive WB detected in | Hela cells |
Positive IHC detected in | human breast cancer tissue, human renal cell carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HUVEC cells, OS-RC-2 cells, MCF-7 cells, HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:200-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IHC | See 1 publications below |
Product Information
66050-1-Ig targets NDUFA4L2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag9233 Product name: Recombinant human NDUFA4L2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-87 aa of BC011910 Sequence: MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF Predict reactive species |
Full Name | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2 |
Calculated Molecular Weight | 87 aa, 10 kDa |
Observed Molecular Weight | 10 kDa |
GenBank Accession Number | BC011910 |
Gene Symbol | NDUFA4L2 |
Gene ID (NCBI) | 56901 |
RRID | AB_11045656 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q9NRX3 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NDUFA4L2, also named as NUOMS, is a HIF-1α target gene that localizes to the mitochondria. It downregulates oxygen consumption and Complex I activity in hypoxia. NDUFA4L2 is involved in hypoxic adaptation by decreasing mitochondrial ROS production.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NDUFA4L2 antibody 66050-1-Ig | Download protocol |
IHC protocol for NDUFA4L2 antibody 66050-1-Ig | Download protocol |
IF protocol for NDUFA4L2 antibody 66050-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Elife Molecular classification and tumor microenvironment characteristics in pheochromocytomas | ||
Cancer Biol Ther NDUFA4L2 reduces mitochondrial respiration resulting in defective lysosomal trafficking in clear cell renal cell carcinoma |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Kristian (Verified Customer) (06-07-2021) | The cells were stained with anti-NDUFA4l2 (green), Phalloidin (purple), and DAPI (blue). The NDUFA4L2 is localized in the mitochondria of the RCC4 cells.
![]() |
FH Daniel (Verified Customer) (04-16-2019) | Specific band in hypoxic mouse kidney. Additional band for Ndufa4.Note: The upper part of the blot (>25 kDa) was stained for a hypoxic marker (Car9).
![]() |