NDUFA9 Polyclonal antibody

NDUFA9 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20312-1-AP

Publications(32)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF-P, ELISA

Synonyms

CI 39kD, CI-39kD, Complex I-39kD, NADH-ubiquinone oxidoreductase 39 kDa subunit, NDUFS2L

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF-P

WB analysis using 20312-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 20312-1-AP (NDUFA9 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 20312-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 20312-1-AP (NDUFA9 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse liver using 20312-1-AP
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 20312-1-AP (NDUFA9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse liver using 20312-1-AP
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 20312-1-AP (NDUFA9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse testis using 20312-1-AP
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using NDUFA9 antibody (20312-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse testis using 20312-1-AP
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using NDUFA9 antibody (20312-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse liver using 20312-1-AP
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using NDUFA9 antibody (20312-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse liver using 20312-1-AP
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using NDUFA9 antibody (20312-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (32)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HeLa cells, mouse heart tissue, rat heart tissue
Positive IHC detected in	mouse liver tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:6000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20312-1-AP targets NDUFA9 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat, pig, zebrafish
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag14150 Product name: Recombinant human NDUFA9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-273 aa of BC009311 Sequence: MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPVYVVDVSKGIVNAVKDPDANGKSFAFVGPSRYLL Predict reactive species
Full Name	NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa
Calculated Molecular Weight	377 aa, 43 kDa
Observed Molecular Weight	35 kDa
GenBank Accession Number	BC009311
Gene Symbol	NDUFA9
Gene ID (NCBI)	4704
RRID	AB_10694678
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q16795
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDUFA9(NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial) is also named as NDUFS2L, CI-39kD and belongs to the complex I NDUFA9 subunit family. It is involved in stabilizing the junction between membrane and matrix arms of complex I, a late assembly step critical for complex I biogenesis and activity.

Protocols

Product Specific Protocols
IF protocol for NDUFA9 antibody 20312-1-AP	Download protocol
IHC protocol for NDUFA9 antibody 20312-1-AP	Download protocol
WB protocol for NDUFA9 antibody 20312-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human	WB	Mol Cell Hepatic micropeptide modulates mitochondrial RNA processing machinery in hepatocellular carcinoma Authors - Linyu Zhu View Article
mouse	WB	Research (Wash D C) LonP1 Links Mitochondria-ER Interaction to Regulate Heart Function Authors - Yujie Li View Article
human	WB	EMBO J EglN2 associates with the NRF1-PGC1α complex and controls mitochondrial function in breast cancer. Authors - Jing Zhang View Article
mouse	WB	Dev Cell Regulation of reverse electron transfer at mitochondrial complex I by unconventional Notch action in cancer stem cells. Authors - Rani Ojha View Article
human	WB	J Cell Biol FAM92A1 is a BAR domain protein required for mitochondrial ultrastructure and function. Authors - Liang Wang View Article
human	WB	Cell Mol Life Sci GTPBP8 is required for mitoribosomal biogenesis and mitochondrial translation Authors - Liang Wang View Article