Tested Applications
Positive WB detected in | A375 cells, mouse heart tissue, human colon tissue |
Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2400 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
Product Information
16902-1-AP targets NDUFB1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag10443 Product name: Recombinant human NDUFB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2-69 aa of BC009691 Sequence: VAVGAEAAAIMVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK Predict reactive species |
Full Name | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa |
Calculated Molecular Weight | 12 kDa, 7 kDa |
Observed Molecular Weight | 7 kDa |
GenBank Accession Number | BC009691 |
Gene Symbol | NDUFB1 |
Gene ID (NCBI) | 4707 |
RRID | AB_2150787 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O75438 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NDUFB1 antibody 16902-1-AP | Download protocol |
IHC protocol for NDUFB1 antibody 16902-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Biol Chem Complex I mutations synergize to worsen the phenotypic expression of Leber's hereditary optic neuropathy. | ||
Cell Rep A membrane arm of mitochondrial complex I sufficient to promote respirasome formation. |