Tested Applications
| Positive WB detected in | A375 cells, mouse heart tissue, human colon tissue |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2400 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16902-1-AP targets NDUFB1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10443 Product name: Recombinant human NDUFB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2-69 aa of BC009691 Sequence: VAVGAEAAAIMVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK Predict reactive species |
| Full Name | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa |
| Calculated Molecular Weight | 12 kDa, 7 kDa |
| Observed Molecular Weight | 7 kDa |
| GenBank Accession Number | BC009691 |
| Gene Symbol | NDUFB1 |
| Gene ID (NCBI) | 4707 |
| RRID | AB_2150787 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75438 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for NDUFB1 antibody 16902-1-AP | Download protocol |
| WB protocol for NDUFB1 antibody 16902-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
J Biol Chem Complex I mutations synergize to worsen the phenotypic expression of Leber's hereditary optic neuropathy. | ||
Cell Rep A membrane arm of mitochondrial complex I sufficient to promote respirasome formation. |









