Tested Applications
| Positive WB detected in | HEK-293T cells, mouse spleen tissue, human heart tissue, mouse heart tissue, rat heart tissue, HuH-7 cells, MCF-7 cells, mouse brain tissue, mouse kidney tissue |
| Positive IHC detected in | mouse brain tissue, human brain tissue, human heart tissue, human kidney tissue, human liver tissue, human ovary tissue, human skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | C2C12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
17614-1-AP targets NDUFB2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11789 Product name: Recombinant human NDUFB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC063026 Sequence: MESHERQPLVLHEEMGECRSSLSAGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED Predict reactive species |
| Full Name | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2, 8kDa |
| Calculated Molecular Weight | 95 aa, 11 kDa |
| Observed Molecular Weight | 8-12 kDa |
| GenBank Accession Number | BC063026 |
| Gene Symbol | NDUFB2 |
| Gene ID (NCBI) | 4708 |
| RRID | AB_2150944 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95178 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The multisubunit NADH:ubiquinone oxidoreductase (complex I) is the first enzyme complex in the electron transport chain of mitochondria. NDUFB2, also named as CI-AGGG, is a nuclear encoded subunit located in the hydrophobic protein fraction of complex I(PMID:9878551). It may have a role in the regulation of molecular changes during the global cardiac ischemia/reperfusion injury during cardiopulmonary bypass (CPB). The full length 12 kDa protein has a transit peptide with 33 amino acids.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NDUFB2 antibody 17614-1-AP | Download protocol |
| IHC protocol for NDUFB2 antibody 17614-1-AP | Download protocol |
| WB protocol for NDUFB2 antibody 17614-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









































