Tested Applications
Positive WB detected in | HEK-293T cells, mouse spleen tissue, human heart tissue, mouse heart tissue, rat heart tissue, HuH-7 cells, MCF-7 cells, mouse brain tissue, mouse kidney tissue |
Positive IHC detected in | mouse brain tissue, human heart tissue, human kidney tissue, human skin tissue, human liver tissue, human ovary tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | C2C12 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
17614-1-AP targets NDUFB2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag11789 Product name: Recombinant human NDUFB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC063026 Sequence: MESHERQPLVLHEEMGECRSSLSAGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED Predict reactive species |
Full Name | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2, 8kDa |
Calculated Molecular Weight | 95 aa, 11 kDa |
Observed Molecular Weight | 8-12 kDa |
GenBank Accession Number | BC063026 |
Gene Symbol | NDUFB2 |
Gene ID (NCBI) | 4708 |
RRID | AB_2150944 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O95178 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The multisubunit NADH:ubiquinone oxidoreductase (complex I) is the first enzyme complex in the electron transport chain of mitochondria. NDUFB2, also named as CI-AGGG, is a nuclear encoded subunit located in the hydrophobic protein fraction of complex I(PMID:9878551). It may have a role in the regulation of molecular changes during the global cardiac ischemia/reperfusion injury during cardiopulmonary bypass (CPB). The full length 12 kDa protein has a transit peptide with 33 amino acids.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NDUFB2 antibody 17614-1-AP | Download protocol |
IHC protocol for NDUFB2 antibody 17614-1-AP | Download protocol |
IF protocol for NDUFB2 antibody 17614-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |