Tested Applications
Positive IHC detected in | human heart tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 2 publications below |
Product Information
23842-1-AP targets NDUFC1 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20835 Product name: Recombinant human NDUFC1 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-76 aa of BC107682 Sequence: MAPSALLRPLSRLLAPARLPSGPSVRSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGLE Predict reactive species |
Full Name | NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1, 6kDa |
Calculated Molecular Weight | 76 aa, 9 kDa |
GenBank Accession Number | BC107682 |
Gene Symbol | NDUFC1 |
Gene ID (NCBI) | 4717 |
RRID | AB_2879336 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O43677 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for NDUFC1 antibody 23842-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
bioRxiv Endocrine persistence in ER+ breast cancer is accompanied by metabolic vulnerability in oxidative phosphorylation
| ||
Cancer Res Oxidative Phosphorylation is a Metabolic Vulnerability of Endocrine Therapy-Tolerant Persister Cells in ER+ Breast Cancer
|