Tested Applications
| Positive WB detected in | rat brain tissue |
| Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
Product Information
26351-1-AP targets Neurofascin in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24165 Product name: Recombinant human NFASC protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 74-185 aa of BC137013 Sequence: RFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQDKRVSQ Predict reactive species |
| Full Name | neurofascin homolog (chicken) |
| Calculated Molecular Weight | 1347 aa, 150 kDa |
| Observed Molecular Weight | 186 kDa |
| GenBank Accession Number | BC137013 |
| Gene Symbol | Neurofascin |
| Gene ID (NCBI) | 23114 |
| RRID | AB_2880486 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O94856 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for Neurofascin antibody 26351-1-AP | Download protocol |
| IHC protocol for Neurofascin antibody 26351-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Aging (Albany NY) Tumor-suppressive miR-3650 inhibits tumor metastasis by directly targeting NFASC in hepatocellular carcinoma. | ||
J Cancer Prev Gene Expression Changes by Diallyl Trisulfide Administration in Chemically-induced Mammary Tumors in Rats. | ||
Cell Rep Med Clinical-proteomic classification and precision treatment strategy of chordoma |





