Tested Applications
| Positive WB detected in | rat brain tissue |
| Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IHC | See 1 publications below |
Product Information
26351-1-AP targets Neurofascin in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24165 Product name: Recombinant human NFASC protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 74-185 aa of BC137013 Sequence: RFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQDKRVSQ Predict reactive species |
| Full Name | neurofascin homolog (chicken) |
| Calculated Molecular Weight | 1347 aa, 150 kDa |
| Observed Molecular Weight | 186 kDa |
| GenBank Accession Number | BC137013 |
| Gene Symbol | Neurofascin |
| Gene ID (NCBI) | 23114 |
| RRID | AB_2880486 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O94856 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Neurofascin (NFASC) is an ankyrin-binding cell adhesion protein that participates in neurite outgrowth, axonal guidance, synaptogenesis, myelination, as well as interactions between neurons and glial cells. The predicted molecular mass of human neurofascin is 150 kDa, while the detected protein band at 186 kDa represents its glycosylated form (PMID: 16337912; 22306302).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Neurofascin antibody 26351-1-AP | Download protocol |
| WB protocol for Neurofascin antibody 26351-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Aging (Albany NY) Tumor-suppressive miR-3650 inhibits tumor metastasis by directly targeting NFASC in hepatocellular carcinoma. | ||
J Cancer Prev Gene Expression Changes by Diallyl Trisulfide Administration in Chemically-induced Mammary Tumors in Rats. | ||
Biomedicines RXR Agonist V-125 Induces Distinct Transcriptional and Immunomodulatory Programs in Mammary Tumors of MMTV-Neu Mice Compared to Bexarotene. | ||
Cell Rep Med Clinical-proteomic classification and precision treatment strategy of chordoma |





