Tested Applications
| Positive WB detected in | HEK-293 cells, MCF-7 cells, mouse kidney tissue, K-562 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 1 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
15136-1-AP targets NME3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7284 Product name: Recombinant human NME3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 22-169 aa of BC000250 Sequence: ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE Predict reactive species |
| Full Name | non-metastatic cells 3, protein expressed in |
| Calculated Molecular Weight | 19 kDa |
| Observed Molecular Weight | 18 kDa |
| GenBank Accession Number | BC000250 |
| Gene Symbol | NME3 |
| Gene ID (NCBI) | 4832 |
| RRID | AB_10858322 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13232 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NME3 (NME/NM23 Nucleoside Diphosphate Kinase 3), also named as NM23-H3; DR-NM23, is a member of the nucleoside diphosphate kinase (NDPK) family that binds to the mitochondrial outer membrane to stimulate mitochondrial fusion. The depletion of NME3 will cause dysfunction in mitochondrial dynamics. NME3 has been found to facilitate DNA-repair mechanisms binds to several NPHPs, including NEK8, CEP164, and ankyrin repeat and sterile α motif domain-containing 6 (ANKS6).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NME3 antibody 15136-1-AP | Download protocol |
| IHC protocol for NME3 antibody 15136-1-AP | Download protocol |
| IP protocol for NME3 antibody 15136-1-AP | Download protocol |
| WB protocol for NME3 antibody 15136-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Biol Chem The nucleoside diphosphate kinase NME3 associates with nephronophthisis proteins, and is required for ciliary function during renal development.
| ||
Onco Targets Ther Exploring Protein Expression Profiles in Lung Cancer Insufficient Microwave Ablation: Implications for Recurrence |















