Tested Applications
| Positive WB detected in | mouse embryo tissue |
| Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26449-1-AP targets NME7 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24918 Product name: Recombinant human NME7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC006983 Sequence: MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSR Predict reactive species |
| Full Name | non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase) |
| Calculated Molecular Weight | 376 aa, 42 kDa |
| Observed Molecular Weight | 38-42 kDa |
| GenBank Accession Number | BC006983 |
| Gene Symbol | NME7 |
| Gene ID (NCBI) | 29922 |
| RRID | AB_2880517 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y5B8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NME7, also named as NDK7, nm23-H7, plays the major role in the synthesis of nucleoside triphosphates other than ATP. NME7 has two isoforms with MW 38-42 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for NME7 antibody 26449-1-AP | Download protocol |
| WB protocol for NME7 antibody 26449-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
FASEB J Integrating Multiomics to Reveal and Validate Key Proteins, Metabolites, and Pathways of ASB14 Affecting Mitochondrial Function in Cardiomyocytes AC16 | ||
Life Sci Alliance NME7 maintains primary cilium assembly, ciliary microtubule stability, and Hedgehog signaling |





