NMUR1 Polyclonal antibody

NMUR1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 14619-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

FM 3, FM3, G protein coupled receptor 66, GPC R, GPR66, neuromedin U receptor 1, NMUR1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman colon tissue, human stomach tissue, mouse pancreas tissue
Positive IHC detected inmouse brain tissue, human colon tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14619-1-AP targets NMUR1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6235

Product name: Recombinant human NMUR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 119-426 aa of BC036543

Sequence: YEMWHNYPFLLGVGGCYFRTLLFEMVCLASVLNVTALSVERYVAVVHPLQARSMVTRAHVRRVLGAVWGLAMLCSLPNTSLHGIQQLHVPCRGPVPDSAVCMLVRPRALYNMVVQTTALLFFCLPMAIMSVLYLLIGLRLRRERLLLMQEAKGRGSAAARSRYTCRLQQHDRGRRQVTKMLFVLVVVFGICWAPFHADRVMWSVVSQWTDGLHLAFQHVHVISGIFFYLGSAANPVLYSLMSSRFRETFQEALCLGACCHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQQETDPS

Predict reactive species
Full Name neuromedin U receptor 1
Calculated Molecular Weight 47 kDa
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC036543
Gene Symbol NMUR1
Gene ID (NCBI) 10316
RRIDAB_2267310
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9HB89
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Neuromedin-U (NMU) is a widely expressed peptide with the highest abundance in the central nervous system (CNS) and intestinal tract of nearly all vertebrate species. NMU mediates several physiological functions via its two cognate receptors, NMUR1 and NMUR2 (PMID:37102164). NMUR1(NmU receptor 1) has the highest expression in peripheral tissues, particularly the GI tract, pancreas, uterus, and testes but has also been reported in peripheral nerve terminals (PMID:10783389).

Protocols

Product Specific Protocols
FC protocol for NMUR1 antibody 14619-1-APDownload protocol
IHC protocol for NMUR1 antibody 14619-1-APDownload protocol
WB protocol for NMUR1 antibody 14619-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...