Tested Applications
Positive WB detected in | MDA-MB-453s cells, BxPC-3 cells, MCF-7 cells, mouse lung tissue, rat kidney tissue |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 4 publications below |
IHC | See 3 publications below |
IF | See 1 publications below |
Product Information
26854-1-AP targets NOP14 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25476 Product name: Recombinant human NOP14 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-95 aa of BC026035 Sequence: MAKAKKVGARRKASGAPAGARGGPAKANSNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARALRKRTQTLLKEYKERDKSNVFRDKRFGEYNSNM Predict reactive species |
Full Name | NOP14 nucleolar protein homolog (yeast) |
Calculated Molecular Weight | 98 kDa |
Observed Molecular Weight | 98 kDa |
GenBank Accession Number | BC026035 |
Gene Symbol | NOP14 |
Gene ID (NCBI) | 8602 |
RRID | AB_2880657 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P78316 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NOP14 antibody 26854-1-AP | Download protocol |
IF protocol for NOP14 antibody 26854-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Prolif CCND1, NOP14 and DNMT3B are involved in miR-502-5p-mediated inhibition of cell migration and proliferation in bladder cancer.
| ||
Aging (Albany NY) Exploring Cancer Dependency Map genes and immune subtypes in colon cancer, in which TIGD1 contributes to colon cancer progression | ||
Int J Biol Macromol CircNOP14 increases the radiosensitivity of hepatocellular carcinoma via inhibition of Ku70-dependent DNA damage repair | ||
Front Biosci (Landmark Ed) NOP14 as a Potential Predictor of Adult-Type Diffuse Glioma Prognosis and Immunotherapy, is Related to Cell Migration, Proliferation, and CD8+T Cell Infiltration |