BNP/NPPB Polyclonal antibody

BNP/NPPB Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 13299-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, ELISA

Natriuretic peptides B, NPPB, BNP, BNP(1 32), BNP(1-28)

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman heart tissue, human brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IHCSee 3 publications below

Product Information

13299-1-AP targets BNP/NPPB in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4039

Product name: Recombinant human BNP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-134 aa of BC025785

Sequence: MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Predict reactive species
Full Name natriuretic peptide precursor B
Calculated Molecular Weight 134 aa, 15 kDa
GenBank Accession NumberBC025785
Gene Symbol BNP
Gene ID (NCBI) 4879
RRIDAB_2877935
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP16860
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NPPB, also known as B-type natriuretic peptide (BNP), is a cardiac hormone that is secreted mainly in the ventricles in response to increased wall stress. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. BNP is a marker of systolic and diastolic dysfunction and a strong predictor of mortality in heart failure patients.

Protocols

Product Specific Protocols
IF protocol for BNP/NPPB antibody 13299-1-APDownload protocol
IHC protocol for BNP/NPPB antibody 13299-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Cell Death Dis

Asb10 accelerates pathological cardiac remodeling by stabilizing HSP70

Authors - Ke Lin

Front Cardiovasc Med

Effects of Excessive Activation of N-methyl-D-aspartic Acid Receptors in Neonatal Cardiac Mitochondrial Dysfunction Induced by Intrauterine Hypoxia.

Authors - Yang Liu

Pharm Biol

Epigallocatechin gallate (EGCG) attenuates myocardial hypertrophy and fibrosis induced by transverse aortic constriction via inhibiting the Akt/mTOR pathway.

Authors - Yue Cui

Int Heart J

Phenotype and Functional Analyses in a Transgenic Mouse Model of Left Ventricular Noncompaction Caused by a DTNA Mutation.

Authors - Qing Cao

Cell Regen

Fabrication of SA/Gel/C scaffold with 3D bioprinting to generate micro-nano porosity structure for skin wound healing: a detailed animal in vivo study.

Authors - Changmei Niu
IHC

Front Pharmacol

Administration of USP7 inhibitor P22077 inhibited cardiac hypertrophy and remodeling in Ang II-induced hypertensive mice

Authors - Yu-Hui Gu
Loading...
||
New chat

Able

正在加载,请稍候...