Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CAR/NR1I3 Polyclonal antibody

CAR/NR1I3 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 21042-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

CAR, Constitutive androstane receptor, NR1I3, CAR BETA, CAR1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, L02 cells
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21042-1-AP targets CAR/NR1I3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15378

Product name: Recombinant human NR1I3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 7-156 aa of BC069651

Sequence: RRTVSKSIGPTCPFAGSCEVSKTQRRHCPACRLQKCLDAGMRKDMILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADINTFMVLQVIKFTKDLPVFRSL

Predict reactive species
Full Name nuclear receptor subfamily 1, group I, member 3
Calculated Molecular Weight 352 aa, 40 kDa
Observed Molecular Weight 45 kDa
GenBank Accession NumberBC069651
Gene Symbol NR1I3
Gene ID (NCBI) 9970
RRIDAB_10732602
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14994
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The nuclear hormone receptor superfamily is a large group of related transcription factors which includes members that bind a diverse array of ligands, including steroids, retinoic acid, thyroid hormone, and vitamin D. Nuclear hormone receptors contain a DNA-binding domain (DBD) and a ligand-binding domain [PMID: 10221899]. Nuclear receptor subfamily 1 group I member 3 (NR1I3; Constitutive androstane receptor: CAR), binds and transactivates the retinoic acid response elements that control expression of the retinoic acid receptor beta 2 and alcohol dehydrogenase 3 genes. It is expressed primarily in liver and regulates the expression of genes involved in xenobiotic metabolism as well as hormone, energy, and lipid homeostasis [PMID:22896671].

Protocols

Product Specific Protocols
IF protocol for CAR/NR1I3 antibody 21042-1-APDownload protocol
WB protocol for CAR/NR1I3 antibody 21042-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

Adv Sci (Weinh)

Constitutive Androstane Receptor in Macrophages Regulates Toll-Like Receptor 4-Mediated Innate Immune Responses Against Endotoxemic Liver Injury

Authors - Renjie Cao
humanWB

Biochem Pharmacol

Constitutive androstane receptor weakens the induction of panaxytriol on CYP3A4 by repressing the activation of pregnane X receptor.

Authors - Qingqing Hu
  • KD Validated
humanWB

Front Pharmacol

Oleanolic Acid and Ursolic Acid Induce UGT1A1 Expression in HepG2 Cells by Activating PXR Rather Than CAR.

Authors - Na Yao
  • KD Validated
humanWB

Xenobiotica

A high-throughput cell-based gaussia luciferase reporter assay for measurement of CYP1A1, CYP2B6, and CYP3A4 induction.

Authors - Han Li
WB,IHC

Chem Biol Interact

NR1I3 inhibits colorectal cancer growth by enhancing PCK1-mediated gluconeogenesis

Authors - Huanying Shi
humanWB

J Ethnopharmacol

Panaxytriol upregulates CYP3A4 expression through the interaction between nuclear regulators and DNA response elements

Authors - Jingdi Yan
  • KD Validated

Reviews

    4.6 out of 5
Add a review

3 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Kamal (Verified Customer) (02-15-2024)

This antibody never lets me down. Purchased again for immunohistochemistry.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse liver tissue

Kamal (Verified Customer) (07-05-2023)

Worked well when diluted in TBST (1:2000) for WB and 1:200 in 1X PBS for IFC.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:2000 (WB) and 1:200 (IFC)
  • Cell Tissue Type: Mouse Liver tissue

Zehua (Verified Customer) (11-07-2019)

It works well for immunoprecipitation!

  • Applications: Western Blot, Immunoprecipitation,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HepG2 cell
CAR/NR1I3 Antibody Western Blot,Immunoprecipitation, validation (1:1000 dilution) in HepG2 cell (Cat no:21042-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...