• Featured Product
  • KD/KO Validated

NRSN2 Polyclonal antibody

NRSN2 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 17574-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

C20orf98, neurensin 2, NRSN2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman brain tissue
Positive IHC detected inhuman brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17574-1-AP targets NRSN2 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10387

Product name: Recombinant human NRSN2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-204 aa of BC001963

Sequence: MMPSCNRSCSCSRGPSVEDGKWYGVRSYLHLFYEDCAGTALSDDPEGPPVLCPRRPWPSLCWKISLSSGTLLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGTALCVAAGVLLAICLFWAMIGWLSQDTKAEPLDPEADSHVEVFGDEPEQQLSPIFRNASGQSWFSPPASPFGQSSVQTIQPKRDS

Predict reactive species
Full Name neurensin 2
Calculated Molecular Weight 204 aa, 22 kDa
Observed Molecular Weight 26 kDa
GenBank Accession NumberBC001963
Gene Symbol NRSN2
Gene ID (NCBI) 80023
RRIDAB_2155379
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9GZP1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for NRSN2 antibody 17574-1-APDownload protocol
WB protocol for NRSN2 antibody 17574-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Am J Cancer Res

NRSN2 promotes osteosarcoma cell proliferation and growth through PI3K/Akt/MTOR and Wnt/β-catenin signaling.

Authors - Ajimu Keremu
  • KD Validated
humanWB

Biomed Pharmacother

Highly expressed NRSN2 is related to malignant phenotype in ovarian cancer.

Authors - Wenbin Tang
  • KD Validated
humanWB, IHC

Dig Dis Sci

Down-Regulated NRSN2 Promotes Cell Proliferation and Survival Through PI3K/Akt/mTOR Pathway in Hepatocellular Carcinoma.

Authors - Xin Wang
humanWB

Int J Clin Exp Pathol

NRSN2 promotes non-small cell lung cancer cell growth through PI3K/Akt/mTOR pathway.

Authors - Xin-Yi Zhang
Loading...
||
New chat Able
正在加载,请稍候...