NSF Polyclonal antibody

NSF Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 21172-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IF, IHC, ELISA

NEM sensitive fusion protein, NSF, SKD2, Vesicle fusing ATPase, Vesicular fusion protein NSF

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, mouse cerebellum tissue, rat brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:100-1:400
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

21172-1-AP targets NSF in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15422

Product name: Recombinant human NSF protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 394-744 aa of BC030613

Sequence: EIGLPDEKGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLDFD

Predict reactive species
Full Name N-ethylmaleimide-sensitive factor
Calculated Molecular Weight 744 aa, 83 kDa
Observed Molecular Weight 83 kDa
GenBank Accession NumberBC030613
Gene Symbol NSF
Gene ID (NCBI) 4905
RRIDAB_2878823
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP46459
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The N-ethylmaleimide-sensitive fusion protein (NSF) is a 70-83 kDa cytosol protein that is expressed in all cell types. NSF functions as an ATPase and it is a part of the 20S membrane fusion apparatus with the vesicular SNAP receptor (v-SNARE) synaptobrevin, and the target SNAREs (t-SNARE) syntaxin and SNAP-25. With the hydrolysis of ATP by NSF, the released energy may set-up or drive membrane fusion processes. NSF is required for general membrane transport and trafficking.

Protocols

Product Specific Protocols
IHC protocol for NSF antibody 21172-1-APDownload protocol
IP protocol for NSF antibody 21172-1-APDownload protocol
WB protocol for NSF antibody 21172-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Cell Death Differ

Transglutaminase 2 crosslinks zona pellucida glycoprotein 3 to prevent polyspermy.

Authors - Zhaokang Cui
Loading...
||
New chat Able
正在加载,请稍候...