Tested Applications
| Positive WB detected in | BxPC-3 cells, HEK-293 cells, MCF-7 cells, SW 1990 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human gliomas tissue, rat pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 7 publications below |
| IHC | See 3 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
| ChIP | See 2 publications below |
Product Information
12023-2-AP targets NUCKS1 in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human, mouse, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2652 Product name: Recombinant human NUCKS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-243 aa of BC000805 Sequence: MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSEDSEDKDVKTKKDDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDEEPESPPEKKTSTSPPPEKSGDEGSEDEAPSGED Predict reactive species |
| Full Name | nuclear casein kinase and cyclin-dependent kinase substrate 1 |
| Calculated Molecular Weight | 243 aa, 27 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | BC000805 |
| Gene Symbol | NUCKS1 |
| Gene ID (NCBI) | 64710 |
| RRID | AB_906407 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H1E3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 (NUCKS1) is a nuclear protein that is highly conserved in vertebrates. The conserved regions of the protein contain several consensus phosphorylation sites for casein kinase II and cyclin-dependent kinases, two putative nuclear localization signals, and a basic DNA-binding domain. It is phosphorylated by CDK1 and casein kinase during mitosis of the cell cycle. Phosphorylated upon DNA damage, probably by ATM or ATR. Widelyexpressed, with highest levels in thyroid gland, prostate and uterus and in fetal liver, thymus and lung. Two isoforms of NUCKS1 exist due to alternative splicing events.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for NUCKS1 antibody 12023-2-AP | Download protocol |
| IP protocol for NUCKS1 antibody 12023-2-AP | Download protocol |
| WB protocol for NUCKS1 antibody 12023-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell SIRT7 regulates NUCKS1 chromatin binding to elicit metabolic and inflammatory gene expression in senescence and liver aging | ||
J Exp Clin Cancer Res Circular RNA circATP9A promotes non-small cell lung cancer progression by interacting with HuR and by promoting extracellular vesicles-mediated macrophage M2 polarization | ||
J Exp Clin Cancer Res NUCKS promotes cell proliferation and suppresses autophagy through the mTOR-Beclin1 pathway in gastric cancer.
| ||
J Cell Physiol NUCKS1 is a novel regulator of milk synthesis in and proliferation of mammary epithelial cells via the mTOR signaling pathway. | ||
Cell Death Dis NUCKS1, a LINC00629-upregulated gene, facilitated osteosarcoma progression and metastasis by elevating asparagine synthesis
|













