• Featured Product
  • KD/KO Validated

OCT4/POU5F1 Polyclonal antibody

OCT4/POU5F1 Polyclonal Antibody for WB, ELISA

Cat No. 11263-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IP, CoIP, ELISA

OCT4, POU5F1, OCT3, Oct-3, Oct-4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, MCF-7 cells, NCCIT cells, MDA-MB-231 cells, mouse brain tissue, U-251 cells, rat brain tissue, mouse embryo tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11263-1-AP targets OCT4/POU5F1 in WB, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, sheep, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1794

Product name: Recombinant human OCT4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 102-265 aa of BC020712

Sequence: MCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN

Predict reactive species
Full Name POU class 5 homeobox 1
Calculated Molecular Weight 39 kDa
Observed Molecular Weight38 kDa, 50-60 kDa
GenBank Accession NumberBC020712
Gene Symbol POU5F1
Gene ID (NCBI) 5460
RRIDAB_2167545
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ01860
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Background

Octamer-binding protein 4 (OCT4), also known as POU5F1 or OCT3/4, is a member of the POU gene family and encoded by the human gene POU5F1 (POU domain class 5 transcription factor 1). OCT4 is a member of the Octamer class of transcription factors that recognize the 8-base pair consensus motif 5'-ATGCAAAT-3'. Expression of OCT4 is associated with an undifferentiated, pluripotent stem cell phenotype and tumors. OCT4 is also expressed in the developing brain, with the highest levels found in the cortex, olfactory bulb, and the hippocampus.

 What is the molecular weight of OCT4?

The molecular weight of OCT4 is 38 kDa.

 What are the isoforms of OCT4?

The human POU51F gene consists of five exons located on chromosome 6 and can generate three mRNA isoforms through alternative splicing - OCT4A, OCT4B, and OCT4B1 (PMID: 18787205). OCT4A and OCT4B1 orchestrate gene transcription in the nucleus supporting self-renewal and pluripotency maintenance in ESCs and embryonal carcinoma cells, whereas OCT4B is localized in the cytoplasm in various non-pluripotent cell types and cannot sustain self-renewal and pluripotency.

 What is OCT4's involvement in pluripotency and self-renewal?

OCT4 forms a trimeric complex with SOX2 and DNA to control the expression of genes involved with embryonic development, such as FGF4 (PMID: 10801796), UTF1 (PMID: 10409735), or even NANOG (PMID: 15743839). OCT4 is critical for early embryogenesis (PMID: 9814708) and for embryonic stem cell pluripotency (PMID: 16153702). High levels of OCT4 are associated with the ability to self-renew, which is emphasized by OCT4 gene knockdowns promoting differentiation (PMID: 10742100). OCT4 is also one of the four key transcription factors used to generate induced pluripotent stem cells (iPSCs) by reprogramming fibroblasts to a pluripotent state (PMID: 16904174).




Protocols

Product Specific Protocols
WB protocol for OCT4/POU5F1 antibody 11263-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Mol Cell

Temporal proteomics during neurogenesis reveals large-scale proteome and organelle remodeling via selective autophagy

Authors - Alban Ordureau
humanWB

Cell Rep Med

CD97 maintains tumorigenicity of glioblastoma stem cells via mTORC2 signaling and is targeted by CAR Th9 cells

Authors - Shuchang Zhou
mouse

Bone Res

Type II collagen-positive progenitors are important stem cells in controlling skeletal development and vascular formation.

Authors - Xinhua Li
humanWB

J Exp Clin Cancer Res

Membrane RRM2-positive cells represent a malignant population with cancer stem cell features in intrahepatic cholangiocarcinoma

Authors - Yongzhi Zhao
mouse

J Control Release

Dual-phase nanoscissors disrupt vasculature-breast cancer stem cell crosstalk for breast cancer treatment

Authors - Yao Qi
humanWB

J Pineal Res

Melatonin inhibits the stemness of head and neck squamous cell carcinoma by modulating HA synthesis via the FOSL1/HAS3 axis

Authors - Xinyue Luo

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Claudia (Verified Customer) (03-06-2026)

Clear band in mouse ESCs 1:2000 overnight incubation

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: mESCs
FH

Zhiping (Verified Customer) (06-21-2023)

This antibody works well for WB.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
FH

Udesh (Verified Customer) (11-18-2022)

Worked well in Osteosarcoma U2OS cells. 20ug protein loaded. Dilution 1:2000 in 5% NFDM.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: U2OS cells
OCT4/POU5F1 Antibody Western Blot validation (1:2000 dilution) in U2OS cells (Cat no:11263-1-AP)
FH

Gongsheng (Verified Customer) (11-02-2022)

This antibody works well in WB, diluation 1:1000, incubation at +4 °C.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: 293T
FH

Silvia (Verified Customer) (10-19-2021)

It works well for Immunofluorescence on hiPSCs

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
Loading...
||
New chat

Able

正在加载,请稍候...