Tested Applications
| Positive WB detected in | rat testis tissue |
| Positive IHC detected in | human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25097-1-AP targets ODF3 in WB, IHC, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18734 Product name: Recombinant human ODF3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 22-102 aa of BC126248 Sequence: LYSSPGPKYLIPPTTGFMKHTPTKLRAPAYSFRGAPMLLAENCSPGPRYNVNPKILRTGKDLGPAYSILGRYQTKTMLTPG Predict reactive species |
| Full Name | outer dense fiber of sperm tails 3 |
| Calculated Molecular Weight | 254 aa, 28 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC126248 |
| Gene Symbol | ODF3 |
| Gene ID (NCBI) | 113746 |
| RRID | AB_2879894 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96PU9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ODF3 antibody 25097-1-AP | Download protocol |
| WB protocol for ODF3 antibody 25097-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





