Tested Applications
| Positive WB detected in | MDA-MB-453s cells, MCF-7 cells |
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28411-1-AP targets ORAI1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29234 Product name: Recombinant human ORAI1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 200-275 aa of BC015369 Sequence: LPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQAAAIASTTIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNE Predict reactive species |
| Full Name | ORAI calcium release-activated calcium modulator 1 |
| Calculated Molecular Weight | 301 aa, 33 kDa |
| Observed Molecular Weight | 45-55 kDa |
| GenBank Accession Number | BC015369 |
| Gene Symbol | ORAI1 |
| Gene ID (NCBI) | 84876 |
| RRID | AB_2918160 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96D31 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Store-operated calcium channels (SOCs) play essential functions in various physiological processes. ORAI1 is a complex glycosylated protein, it exists in several molecular weight forms: a theoretical molecular weight of 32.7 kDa of the unmodified protein and two major glycosylated proteins of ~43 kDa and ~50 kDa (PMID: 22318387). Human patients with a severe combinaed immunodeficiency (SCID) syndrome possess point mutations in Orai1 gene.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ORAI1 antibody 28411-1-AP | Download protocol |
| WB protocol for ORAI1 antibody 28411-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Front Oncol Calcium Channel Protein ORAI1 Mediates TGF-β Induced Epithelial-to-Mesenchymal Transition in Colorectal Cancer Cells.
| ||
J Mol Med (Berl) Phosphate-induced ORAI1 expression and store-operated Ca2+ entry in aortic smooth muscle cells. | ||
Life Sci The role of STIM1/ORAI1 channel in the analgesic effect of grain-sized moxibustion on inflammatory pain mice model. | ||
J Dairy Sci Role of ORAI calcium release-activated calcium modulator 1 (ORAI1) on neutrophil extracellular trap formation in dairy cows with subclinical hypocalcemia.
| ||
J Anim Sci Intracellular Ca2+ signaling and ORAI calcium release-activated calcium modulator 1 (ORAI1) are associated with hepatic lipidosis in dairy cattle. | ||
Exp Lung Res Store-operated Ca2+ entry contributes to the ASM phenotype transition in asthma |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
R. (Verified Customer) (09-16-2024) | Results were spotty. Some non-specific binding occurred.
|







