OSR1 Polyclonal antibody

OSR1 Polyclonal Antibody for ELISA
Cat No. 13386-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

ODD, OSR1, Protein odd skipped related 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

13386-1-AP targets OSR1 in ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4043

Product name: Recombinant human OSR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-266 aa of BC025712

Sequence: MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKPEITAGGSVPALKTKPRFDFANLALAATQEDPAKLGRGEGPGSPAGGLGALLDVTKLSPEKKPTRGRLPSKTKKEFVCKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHSQVKELKTSKIKC

Predict reactive species
Full Name odd-skipped related 1 (Drosophila)
Calculated Molecular Weight 30 kDa
Observed Molecular Weight 58 kDa
GenBank Accession NumberBC025712
Gene Symbol OSR1
Gene ID (NCBI) 130497
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8TAX0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Odd-skipped-related1(OSR1), contains 3 C2H3-type zinc fingers, a tyrosine phosphorylation site and several putative PXXP SH3 binding motifs. It's a transcription factor that has a role in embryonic heart and urogenital development. Expressed during the beginning stages of embryogenesis and during limb and branchial arch development, it possibly participarts in the metanephric kidney formation. OSR1 also plays a key role in the generation of kidney precursor cells and their subsequent differentiation into nephrons. OSR1 is upregulated in several pancreatic and esopha-geal cancer cell lines and downregulated in some primary gastric cancers

Loading...
||
New chat Able
正在加载,请稍候...