Use Able AI chat for product recommendations

PBRM1 Polyclonal antibody

PBRM1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 12563-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Dot blot, ELISA

BAF180, BRG1-associated factor 180, hPB1, PB1, PBRM 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells
Positive IP detected inJurkat cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:5000-1:20000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12563-1-AP targets PBRM1 in WB, IHC, IP, Dot blot, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3148

Product name: Recombinant human PBRM1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-306 aa of BC015323

Sequence: MGEEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKSAKGSAKKEGSKRKINMSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAEYEGMMGGYPPGLPPLQGPVDGLVSMGSMQPLHPGGPPPHHLPPGVPGLPGIPPPGVMNQGVAPMVGTPAPGGSPYGQQVGVLGPPGQQAPPPYPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQTLAARRRDVHLSKEQESRLPSHWLKSKGAHTTMADALWRLRDLMLRDTLNIRQAYNLENV

Predict reactive species
Full Name polybromo 1
Calculated Molecular Weight 180 kDa
Observed Molecular Weight 180-195 kDa, 100 kDa
GenBank Accession NumberBC015323
Gene Symbol PBRM1
Gene ID (NCBI) 55193
RRIDAB_2877865
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ86U86
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PBRM1, also named hPB1 BAF180 and Polybromo-1D, acts as a negative regulator of cell proliferation. PBRM1 is the second major mutated clear cell RCC cancer gene after VHL. PBRM1 loss is associated with low grade features.

Protocols

Product Specific Protocols
IHC protocol for PBRM1 antibody 12563-1-APDownload protocol
IP protocol for PBRM1 antibody 12563-1-APDownload protocol
WB protocol for PBRM1 antibody 12563-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Mol Cell

A di-acetyl-decorated chromatin signature couples liquid condensation to suppress DNA end synapsis

Authors - Kaiwen Bao
Dot blot

Protein Expr Purif

Heterologous expression of the human polybromo-1 protein in the methylotrophic yeast Pichia pastoris.

Authors - Sarah E Hopson
humanWB,IP

Cell Death Dis

The RBPJ/DAPK3/UBE3A signaling axis induces PBRM1 degradation to modulate the sensitivity of renal cell carcinoma to CDK4/6 inhibitors.

Authors - Wentao Liu
humanWB

J Am Heart Assoc

Aging-Associated ALKBH5-m6A Modification Exacerbates Doxorubicin-Induced Cardiomyocyte Apoptosis Via AT-Rich Interaction Domain 2

Authors - Runtai Chen
humanWB

Breast Cancer

Exosomal lncRNA SNHG12 promotes angiogenesis and breast cancer progression

Authors - Yan Chen
Loading...
||
New chat

Able

正在加载,请稍候...