Tested Applications
| Positive WB detected in | HEK-293 cells, SKOV-3 cells, A2780 cells, COLO 320 cells, Jurkat cells |
| Positive IP detected in | A2780 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22323-1-AP targets PBX4 in WB, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17768 Product name: Recombinant human PBX4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 278-374 aa of BC141859 Sequence: EATIYTGKTAVDTTEVGVPGNHASCLSTPSSGSSGPFPLPSAGDAFLTLRTLASLQPPPGGGCLQSQAQGSWQGATPQPATASPAGDPGSINSSTSN Predict reactive species |
| Full Name | pre-B-cell leukemia homeobox 4 |
| Calculated Molecular Weight | 374 aa, 41 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC141859 |
| Gene Symbol | PBX4 |
| Gene ID (NCBI) | 80714 |
| RRID | AB_2879071 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | Q9BYU1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Pre-B-cell leukemia homeobox 4 (PBX4), also named as Homeobox protein PBX4, is one of the pbx gene encode homeodomain containing transcriptional regulators that interact with other proteins to control embryogenesis and tumorigenesis. Pbx 4 expression is confined to the testis, especially to spermatocytes in the pachytene stage of the first meiotic prophase. PBX4 may form heterodimers with other homeobox genes (hoxb1b or meis3) to specify different developmental fates during vertebrate embryogenesis (PMID:10679934). The trimeric complex containing Pbx4, Meis3, and Hoxb1b was also formed. The calculated molecular weight of PBX4 is about 41 kDa, but the molecular weight of heterodimers (PBX4 and hoxb1b) is about 70 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for PBX4 antibody 22323-1-AP | Download protocol |
| WB protocol for PBX4 antibody 22323-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |











