Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Progranulin/PGRN Polyclonal antibody

Progranulin/PGRN Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18410-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

granulin, Epithelin precursor, Glycoprotein 88, Glycoprotein of 88 Kda, Granulin precursor

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, A431 cells, HeLa cells, HEK-293 cells, PC-3 cells, human saliva, mouse heart tissue, mouse lung tissue, rat brain tissue, U-937 cells, THP-1 cells, RAW 264.7 cells
Positive IHC detected inhuman pancreas cancer tissue, human kidney tissue, human lung cancer tissue, human ovary tumor tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18410-1-AP targets Progranulin/PGRN in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13178

Product name: Recombinant human PCDGF,GRN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-363 aa of BC000324

Sequence: MWTLVSWVALTAGLVAGTRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRD

Predict reactive species
Full Name granulin
Calculated Molecular Weight 64 kDa
Observed Molecular Weight 60-70 kDa
GenBank Accession NumberBC000324
Gene Symbol Granulin
Gene ID (NCBI) 2896
RRIDAB_10598161
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP28799
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GRN, also known as PGRN or PCDGF, is a cysteine-rich protein of 68.5 kDa that is typically secreted into a highly glycosylated 88 kDa form. PGRN is a unique growth factor that plays an important role in cutaneous wound healing. It has an anti-inflammatory effect and promotes cell proliferation. When PCDGF is degraded to several 6-25 kDa fragments, called granulins (GRNs) by neutrophil proteases, a pro-inflammatory reaction occurs. PGRN is widely expressed, particularly in epithelial cells, immune cells, neurons, and chondrocytes. High levels of PGRN expression have been reported in human cancers, and its expression is closely correlated with the development and metastasis of several cancers. The recent discovery that mutations in the gene encoding for pro-granulin (GRN) cause frontotemporal lobar degeneration (FTLD), and other neurodegenerative diseases leading to dementia, has brought renewed interest in progranulin and its functions in the central nervous system.

Protocols

Product Specific Protocols
IHC protocol for Progranulin/PGRN antibody 18410-1-APDownload protocol
WB protocol for Progranulin/PGRN antibody 18410-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Phytomedicine

Rg3 inhibits hypoxia-induced tumor exosomes from boosting pancreatic cancer vasculogenic mimicry through the HIF-1α/LARS1/mTOR axis

Authors - Tingting Zhao
ratWB

Transl Psychiatry

Progranulin improves neural development via the PI3K/Akt/GSK-3β pathway in the cerebellum of a VPA-induced rat model of ASD.

Authors - Lili Wang
humanIHC

J Proteome Res

Mining the gastric cancer secretome: identification of GRN as a potential diagnostic marker for early gastric cancer.

Authors - Loei Hendrick H
humanIF

J Mol Med (Berl)

Progranulin alleviates podocyte injury via regulating CAMKK/AMPK-mediated autophagy under diabetic conditions.

Authors - Di Zhou
humanWB

Front Oncol

GRN is a prognostic biomarker and correlated with immune infiltration in glioma: A study based on TCGA data

Authors - Su-Mei Xu
ratWB

Neuropharmacology

Abnormal spatiotemporal expression pattern of progranulin and neurodevelopment impairment in VPA-induced ASD rat model.

Authors - Junying Lan

Reviews

    3.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Sharan (Verified Customer) (06-24-2020)

The antibody detects the GRN protein but there is also a lot of cross-reactivity with non-specific antigens in HeLa lysate

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HeLa cells
Progranulin/PGRN Antibody Western Blot, validation (1:1000 dilution) in HeLa cells (Cat no:18410-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...