Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

PDCD6/ALG2 Polyclonal antibody

PDCD6/ALG2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

ALG2, PDCD6, ALG 2, ALG-2, Apoptosis-linked gene 2 protein homolog

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for PDCD6/ALG2 in ?

Tested Applications

Positive WB detected inHEK-293 cells, Jurkat cells, HeLa cells, HepG2 cells, K-562 cells, NIH/3T3 cells, mouse liver tissue, rat liver tissue
Positive IP detected inHeLa cells
Positive IHC detected inhuman lung cancer tissue, human liver cancer tissue, human stomach tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMDCK cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12303-1-AP targets PDCD6/ALG2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2949

Product name: Recombinant human PDCD6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-191 aa of BC012384

Sequence: MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV

Predict reactive species
Full Name programmed cell death 6
Calculated Molecular Weight 191 aa, 22 kDa
Observed Molecular Weight 15-22 kDa
GenBank Accession NumberBC012384
Gene Symbol PDCD6
Gene ID (NCBI) 10016
RRIDAB_2162459
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75340
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Programmed cell death protein 6 (PDCD6) is also named as ALG2. PDCD6 is an evolutionarily conserved Ca2+-binding protein. PDCD6 is required for coat protein complex II-dependent endoplasmic reticulum-to-Golgi apparatus vesicular transport in the cytoplasm (PMID: 39934130). PDCD6 is involved in regulating multifaceted and pleiotropic cellular processes in different cellular compartments. The nuclear PDCD6 regulates apoptosis and alternative splicing. And cytoplasmic PDCD6 is involved in the regulation of cytoskeletal dynamics and innate immune responses. Additionally, membranous PDCD6 participates in membrane repair through endosomal sorting complex required for transport complex-dependent membrane budding. (PMID: 38436472). PDCD6 also acts as a regulator of cytosolic DNA-induced immune responses by modulating STING transport (PMID: 34787301).

Protocols

Product Specific Protocols
IF protocol for PDCD6/ALG2 antibody 12303-1-APDownload protocol
IHC protocol for PDCD6/ALG2 antibody 12303-1-APDownload protocol
IP protocol for PDCD6/ALG2 antibody 12303-1-APDownload protocol
WB protocol for PDCD6/ALG2 antibody 12303-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The PDCD6/ALG2 Polyclonal antibody (Cat# 12303-1-AP) has 28 citations across journals including Nature, Science, Cell, Mol Cell, EMBO J, Dev Cell, Cell Rep, J Cell Biol, and others. Research fields span lysosomal/endosomal membrane repair, ESCRT-mediated processes, apoptosis regulation, cancer (colorectal, cervical, hepatocellular, ovarian, glioblastoma), neurodegeneration (ALS/FTD), infectious disease (Toxoplasma, Candida, HIV), and calcium signaling.

SpeciesApplicationTitle
humanWB

Nature

Structural basis for dimerization quality control.

Authors - Elijah L Mena
humanWB

Nature

LASER couples damage sensing to ESCRT assembly for lysosome repair.

Authors - Claire S. Goul
humanIF

Nature

Lysosomes drive the piecemeal removal of mitochondrial inner membrane

Authors - Akriti Prashar
humanIF

Science

Triggered recruitment of ESCRT machinery promotes endolysosomal repair.

Authors - Michael L Skowyra
humanWB,IF

Cell

Regulation of the CUL3 Ubiquitin Ligase by a Calcium-Dependent Co-adaptor.

Authors - Colleen A McGourty
  • KD Validated
humanWB

Mol Cell

Co-adaptor driven assembly of a CUL3 E3 ligase complex.

Authors - David Akopian

Reviews

    3.0 out of 5
Add a review

1 verified customer reviews

What customers say

One user reviewed this antibody (PDCD6/ALG2) for immunofluorescence on MDCK cells at a 1:200 dilution, rating it 3 out of 5 stars. The reviewer reported that staining did not reach all cells and suggested the antibody may not perform well in highly polarized MDCK cells. Their protocol involved 4% PFA fixation followed by overnight primary incubation with 0.1% Triton-X and 5% BSA. Overall, the feedback indicates limited effectiveness in this specific cell type and condition.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Kristal (Verified Customer) (06-09-2025)

The PDCD6/ALG2 staining was not reaching all the cells. I am trying to use highly polarized MDCK cells. This specific antibody might not work well in MDCK cells. I fixed in 4% PFA and incubated in primary overnight with 0.1% Triton-X and 5% BSA.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: MDCK cells
PDCD6/ALG2 Antibody Immunofluorescence validation (1:200 dilution) in MDCK cells (Cat no:12303-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...