Filter: AllWBIPIHCIF/ICC

WB analysis using 10582-1-AP
Various cells were subjected to SDS PAGE followed by western blot with 10582-1-AP (PELO antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
WB analysis of mouse testis using 10582-1-AP
mouse testis tissue were subjected to SDS PAGE followed by western blot with 10582-1-AP (PELO antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
WB analysis of HEK-293 using 10582-1-AP
HEK-293 cells were subjected to SDS PAGE followed by western blot with 10582-1-AP (PELO antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 10582-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 10582-1-AP (PELO antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of mouse testis using 10582-1-AP
mouse testis tissue were subjected to SDS PAGE followed by western blot with 10582-1-AP (PELO antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
IP experiment of HEK-293 using 10582-1-AP
IP result of anti-PELO (IP:10582-1-AP, 4ug; Detection:10582-1-AP 1:500) with HEK-293 cells lysate 1200ug.
IHC staining of human liver using 10582-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10582-1-AP (PELO antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver using 10582-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10582-1-AP (PELO antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human ovary cancer using 10582-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 10582-1-AP (PELO antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse pancreas using 10582-1-AP
Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 10582-1-AP (PELO antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of rat ovary using 10582-1-AP
Immunohistochemical analysis of paraffin-embedded rat ovary tissue slide using 10582-1-AP (PELO antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse stomach using 10582-1-AP
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 10582-1-AP (PELO antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of HeLa using 10582-1-AP
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PELO antibody (10582-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

Featured Product
KD/KO Validated

PELO Polyclonal antibody

PELO Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10582-1-AP

Publications(14)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

CGI 17, CGI-17, hPelota, PRO1770, Protein Dom34 homolog

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (14)
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HEK-293 cells, mouse testis tissue, HeLa cells, SKOV-3 cells
Positive IP detected in	HEK-293 cells
Positive IHC detected in	human ovary cancer tissue, human liver tissue, mouse pancreas tissue, mouse stomach tissue, rat ovary tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:6000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:250-1:1000
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 2 publications below
WB	See 12 publications below
IF	See 1 publications below
IP	See 1 publications below

Product Information

10582-1-AP targets PELO in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag0873 Product name: Recombinant human PELO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 42-384 aa of BC005889 Sequence: STIRKVQTESSTGSVGSNRVRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFDVVKCILVASPGFVREQFCDYMFQQAVKTDNKLLLENRSKFLQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEE Predict reactive species
Full Name	pelota homolog (Drosophila)
Calculated Molecular Weight	43 kDa
Observed Molecular Weight	43-45 kDa
GenBank Accession Number	BC005889
Gene Symbol	PELO
Gene ID (NCBI)	53918
RRID	AB_2236833
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9BRX2
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The Pelo gene was originally identified in a mutagenesis screen for spermatogenesis-specific genes of Drosophila melanogaster. The PELO is required for the meiotic division during the G2/M transition, and functions in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs [PMID:12556505]. It may participate in the machinery of protein synthesis or in the regulation of mRNA translation [PMID:9584085].

Protocols

Product Specific Protocols
IF protocol for PELO antibody 10582-1-AP	Download protocol
IHC protocol for PELO antibody 10582-1-AP	Download protocol
IP protocol for PELO antibody 10582-1-AP	Download protocol
WB protocol for PELO antibody 10582-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
	WB	Nat Commun Stalled translation by mitochondrial stress upregulates a CNOT4-ZNF598 ribosomal quality control pathway important for tissue homeostasis Authors - Ji Geng View Article
human	WB	Mol Cell Unresolved stalled ribosome complexes restrict cell-cycle progression after genotoxic stress. Authors - Mark Stoneley View Article
human	WB	Nucleic Acids Res XAB2 depletion induces intron retention in POLR2A to impair global transcription and promote cellular senescence. Authors - Shuai Hou View Article
mouse	WB	Elife Defects in translation-dependent quality control pathways lead to convergent molecular and neurodevelopmental pathology. Authors - Markus Terrey View Article
human		Cell Rep A role for the ribosome-associated complex in activation of the IRE1 branch of UPR. Authors - I-Hui Wu KD Validated View Article
human		Res Sq Translation stalling induced mitochondrial entrapment of ribosomal quality control related proteins offers cancer cell vulnerability Authors - Rani Ojha View Article