Filter:
Tested Applications
| Positive WB detected in | mouse testis tissue, human testis tissue |
| Positive IHC detected in | human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2400 |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13686-1-AP targets PGK2 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4553 Product name: Recombinant human PGK2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 242-360 aa of BC038843 Sequence: YTFLKVLNNMEIGASLFDEEGAKIVKDIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGPLGVFEWDAFAKGTKALMDEIV Predict reactive species |
| Full Name | phosphoglycerate kinase 2 |
| Calculated Molecular Weight | 417 aa, 45 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | BC038843 |
| Gene Symbol | PGK2 |
| Gene ID (NCBI) | 5232 |
| RRID | AB_2161237 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P07205 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PGK2, phosphoglycerate kinase 2, which belongs to the phosphoglycerate kinase superfamily. It catalyzes the first ATP-generating step in the central metabolic pathway of glycolysis, converting 1,3-bisphosphoglycerate and ADP to 3-phosphoglycerate and ATP.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PGK2 antibody 13686-1-AP | Download protocol |
| IHC protocol for PGK2 antibody 13686-1-AP | Download protocol |
| WB protocol for PGK2 antibody 13686-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Chemosphere Arsenic influences spermatogenesis by disorganizing the elongation of spermatids in adult male mice. | ||
Theriogenology Characterization of GALNTL5 gene sequence and expression in ovine testes and sperm. | ||
Mol Cell Proteomics Lactylated Proteomic Analysis Reveals Functional Implications of Lysine Lactylation In Asthenozoospermia. | ||
Mol Ther METTL5 deficiency induces oligoasthenoteratozoospermia via impaired 18S rRNA m(6)A methylation in humans and mice. | ||
