Tested Applications
| Positive IHC detected in | human breast cancer tissue, human skin tissue, human breast tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16068-1-AP targets GCDFP-15/PIP in IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9004 Product name: Recombinant human GCDFP-15, PIP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 28-146 aa of BC010950 Sequence: AQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE Predict reactive species |
| Full Name | prolactin-induced protein |
| Calculated Molecular Weight | 146 aa, 17 kDa |
| GenBank Accession Number | BC010950 |
| Gene Symbol | GCDFP-15 |
| Gene ID (NCBI) | 5304 |
| RRID | AB_2878212 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P12273 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GCDFP-15 (gross cystic disease fluid protein 15), also known as PIP (prolactin-induced protein) is a secretory glycoprotein expressed in benign and malignant breast tumor tissues and in some normal exocrine organs such as sweat, salivary, and lacrimal glands (PMID: 12393800). GCDFP-15 expression is increased by prolactin and androgen and inhibited by estrogen (PMID: 18854942). The expression is also regulated by interleukins. GCDFP-15 is a marker of apocrine differentiation and is frequently used for assessment of metastases or regional recurrences of breast origin.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GCDFP-15/PIP antibody 16068-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









































