Tested Applications
Positive WB detected in | mouse brain tissue |
Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
25013-1-AP targets PIPPIN in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16216 Product name: Recombinant human CSDC2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC067113 Sequence: MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEG Predict reactive species |
Full Name | cold shock domain containing C2, RNA binding |
Calculated Molecular Weight | 153 aa, 17 kDa |
Observed Molecular Weight | 30 kDa |
GenBank Accession Number | BC067113 |
Gene Symbol | CSDC2 |
Gene ID (NCBI) | 27254 |
RRID | AB_2879845 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y534 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PIPPIN, also known as CSDC2 (Cold shock domain-containing protein C2) is an RNA‐binding protein (RBP), highly enriched in the rat brain, specifically enriched in some pyramidal neurons of the cerebral cortex and in the Purkinje cells of the cerebellum (PMID: 10446180). PIPPIN has the potential to undergo different posttranslational modifications and might be a good candidate to regulate the synthesis of specific proteins in response to extracellular stimuli. Nuclear CSDC2 is connected to proliferation and cytoplasmic CSDC2 to terminal differentiation in the decidua and that CSDC2 could regulate differentiation during decidua development (PMID: 30078185, PMID: 17053029).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PIPPIN antibody 25013-1-AP | Download protocol |
IHC protocol for PIPPIN antibody 25013-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |