Tested Applications
Positive WB detected in | mouse heart tissue |
Positive IF/ICC detected in | Hela cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
21371-1-AP targets PKIG in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15878 Product name: Recombinant human PKIG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-76 aa of BC104257 Sequence: MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSSDGTTSS Predict reactive species |
Full Name | protein kinase (cAMP-dependent, catalytic) inhibitor gamma |
Calculated Molecular Weight | 76 aa, 8 kDa |
Observed Molecular Weight | 5-8 kDa |
GenBank Accession Number | BC104257 |
Gene Symbol | PKIG |
Gene ID (NCBI) | 11142 |
RRID | AB_10858922 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y2B9 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PKIG antibody 21371-1-AP | Download protocol |
IF protocol for PKIG antibody 21371-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |