Tested Applications
| Positive WB detected in | human peripheral blood leukocyte, PANC-1 cells |
| Positive IHC detected in | human placenta tissue, human brain tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 4 publications below |
| IHC | See 4 publications below |
| IF | See 2 publications below |
| CoIP | See 2 publications below |
Product Information
12284-1-AP targets PLAC8 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2939 Product name: Recombinant human PLAC8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC012205 Sequence: MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF Predict reactive species |
| Full Name | placenta-specific 8 |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC012205 |
| Gene Symbol | PLAC8 |
| Gene ID (NCBI) | 51316 |
| RRID | AB_11182285 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NZF1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PLAC8, also named as Protein C15, is a placenta-specific protein. The expression was downregulated upon activation, particularly in dendritic cells generated in vitro from CD34 (142230) progenitor cells. The MW of PLAC8 is about 12-20kd.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PLAC8 antibody 12284-1-AP | Download protocol |
| WB protocol for PLAC8 antibody 12284-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
FASEB J PLAC8 promotes the autophagic activity and improves the growth priority of human trophoblast cells. | ||
Int J Med Sci Expression profiling of lncRNAs and mRNAs in placental site trophoblastic tumor (PSTT) by microarray. | ||
Histochem Cell Biol PLAC8 contributes to the malignant behaviors of cervical cancer cells by activating the SOX4-mediated AKT pathway
| ||
Front Immunol Identification and validation of immune and diagnostic biomarkers for interstitial cystitis/painful bladder syndrome by integrating bioinformatics and machine-learning | ||
Commun Biol PLAC8 attenuates pulmonary fibrosis and inhibits apoptosis of alveolar epithelial cells via facilitating autophagy | ||
PLoS Genet Single-cell RNA profiling reveals classification and characteristics of mononuclear phagocytes in colorectal cancer |















