Tested Applications
| Positive WB detected in | A431 cells, HEK-293 cells, HeLa cells, HepG2 cells, NIH/3T3 cells |
| Positive IP detected in | A431 cells |
| Positive IHC detected in | human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
12917-1-AP targets PLS3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3574 Product name: Recombinant human PLS3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 281-630 aa of BC039049 Sequence: LENSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV Predict reactive species |
| Full Name | plastin 3 (T isoform) |
| Calculated Molecular Weight | 630 aa, 71 kDa |
| Observed Molecular Weight | 68 kDa |
| GenBank Accession Number | BC039049 |
| Gene Symbol | PLS3 |
| Gene ID (NCBI) | 5358 |
| RRID | AB_2877892 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P13797 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PLS3, also named T-plastin and Plastin-3, is an actin-bundling protein found in intestinal microvilli, hair cell stereocilia, and fibroblast filopodia. It plays an important role in leukocyte function. L-plastin plays an important role in leukocyte function, and T-plastin is possibly involved in DNA repair. Both T- and L-plastin are implicated in several diseases, and L-plastin is considered to be a valuable marker for cancer (PMID: 15960882).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PLS3 antibody 12917-1-AP | Download protocol |
| IHC protocol for PLS3 antibody 12917-1-AP | Download protocol |
| IP protocol for PLS3 antibody 12917-1-AP | Download protocol |
| WB protocol for PLS3 antibody 12917-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Gaurav (Verified Customer) (02-06-2024) | Excellent antibody with expected molecular weight at right position. Works very well in knock out samples of Smooth Muscle Cells. Works even better at room temperature also. Very stable antibody.
![]() |














