• Featured Product
  • KD/KO Validated

PMM2 Polyclonal antibody

PMM2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 10666-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

phosphomannomutase 2, EC:5.4.2.8

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, multi-tissue
Positive IP detected inmouse lung tissue
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10666-1-AP targets PMM2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1031

Product name: Recombinant human PMM2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-246 aa of BC008310

Sequence: MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS

Predict reactive species
Full Name phosphomannomutase 2
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 28-30 kDa
GenBank Accession NumberBC008310
Gene Symbol PMM2
Gene ID (NCBI) 5373
RRIDAB_2166973
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO15305
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PMM2(Phosphomannomutase 2) belongs to the eukaryotic PMM family. It is involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions. PMM2 catalyzes the second step in the conversion of fructose-6P to GDP-mannose.

Protocols

Product Specific Protocols
IF protocol for PMM2 antibody 10666-1-APDownload protocol
IHC protocol for PMM2 antibody 10666-1-APDownload protocol
IP protocol for PMM2 antibody 10666-1-APDownload protocol
WB protocol for PMM2 antibody 10666-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Thromb Haemost

N-Glycosylation Deficiency Reduces the Activation of Protein C and Disrupts Endothelial Barrier Integrity

Authors - Tiffany Pascreau
  • KD Validated
mouseWB

J Proteome Res

Changes in the striatal proteome of YAC128Q mice exhibit gene-environment interactions between mutant huntingtin and manganese.

Authors - Wegrzynowicz Michal M
humanWB

Mol Genet Metab

Complex metabolic disharmony in PMM2-CDG paves the way to new therapeutic approaches

Authors - Nastassja Himmelreich
humanWB

J Inherit Metab Dis

Lack of phosphomannomutase 2 affects Xenopus laevis morphogenesis and the non-canonical Wnt5a/Ror2 signalling.

Authors - Nastassja Himmelreich
humanWB

Dis Model Mech

Repurposing the aldose reductase inhibitor and diabetic neuropathy drug epalrestat for the congenital disorder of glycosylation PMM2-CDG.

Authors - Sangeetha Iyer
WB

PLoS One

Heterodimerization of Two Pathological Mutants Enhances the Activity of Human Phosphomannomutase2.

Authors - Giuseppina Andreotti
Loading...
||
New chat Able
正在加载,请稍候...