• Featured Product
  • KD/KO Validated

POFUT1 Polyclonal antibody

POFUT1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 14929-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

EC:2.4.1.221, FUT12, GDP-fucose protein O-fucosyltransferase 1, KIAA0180, O Fuc T

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHCT 116 cells, HUVEC cells
Positive IP detected inHepG2 cells
Positive IHC detected inhuman liver cancer tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHUVEC cells, A431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14929-1-AP targets POFUT1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6710

Product name: Recombinant human POFUT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-182 aa of BC000582

Sequence: MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRR

Predict reactive species
Full Name protein O-fucosyltransferase 1
Calculated Molecular Weight 44 kDa
Observed Molecular Weight 44 kDa
GenBank Accession NumberBC000582
Gene Symbol POFUT1
Gene ID (NCBI) 23509
RRIDAB_2166123
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H488
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

POFUT1 (protein O-fucosyltransferase 1), also known as GDP-fucose protein O-fucosyltransferase, is an enzyme that catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in EGF domains and plays a crucial role in Notch signaling.

Protocols

Product Specific Protocols
IF protocol for POFUT1 antibody 14929-1-APDownload protocol
IHC protocol for POFUT1 antibody 14929-1-APDownload protocol
IP protocol for POFUT1 antibody 14929-1-APDownload protocol
WB protocol for POFUT1 antibody 14929-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Cell

In vivo CRISPR screening reveals nutrient signaling processes underpinning CD8+ T cell fate decisions.

Authors - Hongling Huang
  • KO Validated
humanWB,IHC,IF

EBioMedicine

PLAGL2 and POFUT1 are regulated by an evolutionarily conserved bidirectional promoter and are collaboratively involved in colorectal cancer by maintaining stemness.

Authors - Daojiang Li
  • KD Validated
humanWB

EMBO Mol Med

A spoonful of L-fucose-an efficient therapy for GFUS-CDG, a new glycosylation disorder

Authors - Rene G Feichtinger
humanWB,IHC,IF

Cell Death Dis

POFUT1 promotes colorectal cancer development through the activation of Notch1 signaling.

Authors - Yuheng Du
  • KD Validated
humanIHC,IF

Cell Death Dis

LIF upregulates poFUT1 expression and promotes trophoblast cell migration and invasion at the fetal-maternal interface.

Authors - S Liu
humanWB

Cell Prolif

Epiregulin promotes trophoblast epithelial-mesenchymal transition through poFUT1 and O-fucosylation by poFUT1 on uPA.

Authors - Xinyuan Cui

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

fei (Verified Customer) (09-04-2025)

This antibody was used for WB, IP, and IF experiments. Overall, the results were good. The weaker signal in WB may be related to the cell type.

  • Applications: Western Blot, Immunofluorescence, Immunoprecipitation
  • Cell Tissue Type: pancreatic beta cells
Loading...
||
New chat Able
正在加载,请稍候...