POLR1D Polyclonal antibody

POLR1D Polyclonal Antibody for WB, IP, ELISA

Cat No. 12254-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

AC19, hRPA19, POLR1C, POLR1D, RPA16, RPA9, RPAC2, RPC16, RPO1 3

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllWBIP

WB analysis of HeLa using 12254-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 12254-1-AP (POLR1D antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Jurkat using 12254-1-AP
Jurkat cells were subjected to SDS PAGE followed by western blot with 12254-1-AP (POLR1D antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse lung using 12254-1-AP
mouse lung tissue were subjected to SDS PAGE followed by western blot with 12254-1-AP (POLR1D antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of HeLa using 12254-1-AP
IP result of anti-POLR1D (IP:12254-1-AP, 4ug; Detection:12254-1-AP 1:500) with HeLa cells lysate 2600 ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Positive WB detected in	HeLa cells, Jurkat cells, mouse lung tissue
Positive IP detected in	HeLa cells

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

12254-1-AP targets POLR1D in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2904 Product name: Recombinant human POLR1D protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC015319 Sequence: MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR Predict reactive species
Full Name	polymerase (RNA) I polypeptide D, 16kDa
Calculated Molecular Weight	16 kDa
Observed Molecular Weight	20 kDa
GenBank Accession Number	BC015319
Gene Symbol	POLR1D
Gene ID (NCBI)	51082
RRID	AB_10640535
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P0DPB6
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.