Filter: AllIHCIF/ICC

IHC staining of human gliomas using 11084-1-AP
Immunohistochemical analysis of paraffin-embedded human gliomas using 11084-1-AP (POLR3K antibody) at dilution of 1:100 (under 10x lens).
IHC staining of mouse testis using 11084-1-AP
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11084-1-AP (POLR3K antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse testis using 11084-1-AP
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11084-1-AP (POLR3K antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse testis using 11084-1-AP
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11084-1-AP (POLR3K antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse testis using 11084-1-AP
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11084-1-AP (POLR3K antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of HepG2 using 11084-1-AP
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using POLR3K antibody (11084-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).
IF Staining of HepG2 using 11084-1-AP
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 11084-1-AP (POLR3K antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

POLR3K Polyclonal antibody

Name: POLR3K Polyclonal antibody
Brand: Proteintech
SKU: 11084-1-AP

POLR3K Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 11084-1-AP

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, ELISA

Synonyms

HsC11p, hRPC11, DNA-directed RNA polymerase III subunit RPC10, DNA-directed RNA polymerase III subunit K, C11 RNP3

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive IHC detected in	mouse testis tissue, human gliomas tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells

Recommended dilution

Application	Dilution
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11084-1-AP targets POLR3K in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag1564 Product name: Recombinant human POLR3K protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC011932 Sequence: MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD Predict reactive species
Full Name	polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa
Calculated Molecular Weight	12 kDa
GenBank Accession Number	BC011932
Gene Symbol	POLR3K
Gene ID (NCBI)	51728
RRID	AB_2165725
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9Y2Y1
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.