Tested Applications
| Positive WB detected in | human testis tissue, mouse skeletal muscle tissue |
| Positive IHC detected in | human ovary cancer tissue, human ovary tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24593-1-AP targets POTEA in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20228 Product name: Recombinant human POTEA protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 411-498 aa of BC153076 Sequence: IHSVDNLDDITWPSEIASEDYDLLFSNYETFTLLIEQLKMDFNDSASLSKIQDAVISEEHLLELKNSHYEQLTVEVEQMENMVHVLQK Predict reactive species |
| Full Name | POTE ankyrin domain family, member A |
| Calculated Molecular Weight | 498 aa, 56 kDa |
| Observed Molecular Weight | 53 kDa |
| GenBank Accession Number | BC153076 |
| Gene Symbol | POTEA |
| Gene ID (NCBI) | 340441 |
| RRID | AB_2879627 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6S8J7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
POTEA also named as ANKRD26 like family A member 1 or POTE8 is a 498 amino acid protein, which contains five ANK repeats and belongs to the POTE family. POTEA has an important signaling function in the reproductive system.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for POTEA antibody 24593-1-AP | Download protocol |
| WB protocol for POTEA antibody 24593-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |













