Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue |
| Positive IP detected in | mouse skeletal muscle tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20635-1-AP targets PPAPDC3 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14676 Product name: Recombinant human PPAPDC3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC006362 Sequence: MPASQSRARARDRNNVLNRAEFLSLNQPPKGGPEPRSSGRKASGPSAQPPPAGDGARERRQSQQL Predict reactive species |
| Full Name | phosphatidic acid phosphatase type 2 domain containing 3 |
| Calculated Molecular Weight | 271 aa, 29 kDa |
| Observed Molecular Weight | 29 kDa |
| GenBank Accession Number | BC006362 |
| Gene Symbol | PPAPDC3 |
| Gene ID (NCBI) | 84814 |
| RRID | AB_10696180 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8NBV4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PPAPDC3(Phosphatidic acid phosphatase type 2 domain-containing protein 3) is also named as C9orf67 and belongs to the PA-phosphatase related phosphoesterase family. It plays a role as negative regulator of myoblast differentiation, in part through effects on MTOR signaling.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for PPAPDC3 antibody 20635-1-AP | Download protocol |
| WB protocol for PPAPDC3 antibody 20635-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PPAPDC3 Polyclonal antibody (Cat# 20635-1-AP) has a total of 3 citations. These citations appear in Genome Biology, Cells, and Frontiers in Cell and Developmental Biology. The associated research fields include nuclear envelope transmembrane protein function, genome organization and chromosome positioning, and muscular dystrophy (including LMNA-congenital muscular dystrophy, Emery-Dreifuss muscular dystrophy, and myotonic dystrophy type 1). All citations used the antibody for Western blot in human samples.
| Species | Application | Title |
|---|---|---|
Genome Biol Specific nuclear envelope transmembrane proteins can promote the location of chromosomes to and from the nuclear periphery. | ||
Cells Lamin A/C Assembly Defects in LMNA-Congenital Muscular Dystrophy Is Responsible for the Increased Severity of the Disease Compared with Emery-Dreifuss Muscular Dystrophy. | ||
Front Cell Dev Biol Nuclear envelope transmembrane proteins involved in genome organization are misregulated in myotonic dystrophy type 1 muscle |
