Use Able AI chat for product recommendations

Cyclophilin E Polyclonal antibody

Cyclophilin E Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15357-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

PPIE, Cyclophilin 33, Cyclophilin-33, CYP 33, CYP33

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inBxPC-3 cells, HeLa cells, Jurkat cells
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15357-1-AP targets Cyclophilin E in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7603

Product name: Recombinant human PPIE protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-301 aa of BC004898

Sequence: MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV

Predict reactive species
Full Name peptidylprolyl isomerase E (cyclophilin E)
Calculated Molecular Weight 33 kDa
Observed Molecular Weight 33-38 kDa
GenBank Accession NumberBC004898
Gene Symbol Cyclophilin E
Gene ID (NCBI) 10450
RRIDAB_2878131
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UNP9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclophilin E (CypE), also known as Cyclophilin-33, Rotamase E, CYP33, PPIE, is an enzyme which belongs to the cyclophilin-type PPIase family of PPIase E subfamily (PMID: 15998457). Cyclophilin E negatively regulates influenza virus replication and transcription occurs by impairing the formation of the vRNP (PMID: 21887220). Additionally, Cyclophilin E plays an important role in osteoblast differentiation as a positive regulator by increasing the transcriptional activity of Runx2 (PMID: 37947627).

Protocols

Product Specific Protocols
IF protocol for Cyclophilin E antibody 15357-1-APDownload protocol
IHC protocol for Cyclophilin E antibody 15357-1-APDownload protocol
WB protocol for Cyclophilin E antibody 15357-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

    3.6 out of 5
Add a review

3 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Aleksandr (Verified Customer) (07-19-2025)

Overall antibody recognize the band of the expected size, but there are several non-specific bands

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: RKO
Cyclophilin E Antibody Western Blot validation (1:2000 dilution) in RKO (Cat no:15357-1-AP)

Moritz (Verified Customer) (09-12-2024)

Several bands were observable in WB, also the expected size of PPIE, although it was not the strongest.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: HEK293T
Cyclophilin E Antibody Western Blot validation (1:3000 dilution) in HEK293T (Cat no:15357-1-AP)

Tsimafei (Verified Customer) (08-12-2024)

Multiple bands are present, however the one corresponding to Cyclophilin E size (~33 kDa) is clearly visible

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: mESCs
Cyclophilin E Antibody Western Blot validation (1:3000 dilution) in mESCs (Cat no:15357-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...